Citrus Sinensis ID: 047674


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
AAELRLKINKCIHKASLSPDKQEKEEGVVANGEEEEEDYCEESERLLSIHQALESLEAQLSNLQNLQLQQRYDREVALAEIEFSRKMLLEKLKEYRGEDLEVIHEASAFAGETVQHDNDLLLPPYPNRLPLSLTLENGYLSQFRYPRKSVQNGVITGELTKEGNKNIYESERNQVQTGSTTSRKGFGHFISSLAKTLLPLVGVVYVLNMSGVAQNLGKKSAPLKFLGIFRQPVIDEKRSVFNVQCPPGKVLVVEGGEARCIVKERVEIPFDSVAVKPDINYGSG
cHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEccEEEEEEEEEEEccccccccccccccccc
**ELRLKINKCI****************************EESERLLSIHQALESLEAQLSNLQNLQLQQRYDREVALAEIEFSRKMLLEKLKEYRGEDLEVIHEASAFAGETVQHDNDLLLPPYPNRLPLSLTLENGYLSQFRY***************************************GFGHFISSLAKTLLPLVGVVYVLNMSGVAQNLGKKSAPLKFLGIFRQ******RSVFNVQCPPGKVLVVEGGEARCIVKERVEIPFDSVAVKPDINYGS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AAELRLKINKCIHKASLSPDKQEKEEGVVANGEEEEEDYCEESERxxxxxxxxxxxxxxxxxxxxxxxxQRYDREVALAEIEFSRKMLLEKLKEYRGEDLEVIHEASAFAGETVQHDNDLLLPPYPNRLPLSLTLENGYLSQFRYPRKSVQNGVITGELTKEGNKNIYESERNQVQTGSTTSRKGFGHFISSLAKTLLPLVGVVYVLNMSGVAQNLGKKSAPLKFLGIFRQPVIDEKRSVFNVQCPPGKVLVVEGGEARCIVKERVEIPFDSVAVKPDINYGSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Plastid division protein PDV2 Component of the plastid division machinery. Required to mediate the recruitment of ARC5 at the midplastid constriction site in the cytoplasm. Relays plastid division site position between stroma and outer surface via interactions with the cytoplasmic ARC5 and the inner membrane ARC6 that recruits stromal FtsZ ring.probableQ9XII1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted