BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047712
         (452 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1HX1|B Chain B, Crystal Structure Of A Bag Domain In Complex With The
           Hsc70 Atpase Domain
 pdb|3FZF|B Chain B, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP
 pdb|3FZH|B Chain B, Crystal Structures Of Hsc70BAG1 IN COMPLEX WITH SMALL
           Molecule Inhibitors
 pdb|3FZK|B Chain B, Crystal Structures Of Hsc70BAG1 IN COMPLEX WITH SMALL
           Molecule Inhibitors
 pdb|3FZL|B Chain B, Crystal Structures Of Hsc70BAG1 IN COMPLEX WITH SMALL
           Molecule Inhibitors
 pdb|3FZM|B Chain B, Crystal Structures Of Hsc70BAG1 IN COMPLEX WITH SMALL
           Molecule Inhibitors
 pdb|3LDQ|B Chain B, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH SMALL
           MOLECULE Inhibitor
 pdb|3M3Z|B Chain B, Crystal Structure Of Hsc70/bag1 In Complex With Small
           Molecule Inhibitor
          Length = 114

 Score = 29.6 bits (65), Expect = 3.3,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 9/65 (13%)

Query: 316 QLKKLKLQVDRLALEQPSAERVADILHQVDRESLGLQNHLLNEDYSLAQEALVQSKLDIS 375
           +LKKLK       LE+ S E++AD L ++++E  G+Q   L +D  L  EAL +    + 
Sbjct: 9   ELKKLK------HLEK-SVEKIADQLEELNKELTGIQQGFLPKD--LQAEALCKLDRRVK 59

Query: 376 PTQER 380
            T E+
Sbjct: 60  ATIEQ 64


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,599,369
Number of Sequences: 62578
Number of extensions: 506271
Number of successful extensions: 989
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 989
Number of HSP's gapped (non-prelim): 1
length of query: 452
length of database: 14,973,337
effective HSP length: 102
effective length of query: 350
effective length of database: 8,590,381
effective search space: 3006633350
effective search space used: 3006633350
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)