Citrus Sinensis ID: 047754

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MSNHEGQPYCKIGYVFAPNKEQTVIQPSLITKATEQGIGLIRIDPDKPLTEQGPFDCIMHKLYGPDWTQQLQQFSSRNPDVRIIDPPESIERLHNRDSMLEVVSRLKIELNKEKVSVPNQAVVSETELVTRDMAIEELKLRFPLIAKPLEANGSDKSHQMYLIFDNEGLEVLEAPILLQEFVNHGGIIFKVYVAGSSVKCVKRKSLPDISEEKMKSLKGFLPFSQISSNSVDADEEVDLEKTEMPREGFVVELSRALREALGLNLFNFDLIRDAGERDGYLVIDINYLPGYAKLPGYETLLMDFFLNVAKSKAVEEVTSGDELNESVCLQ
cccccccccEEEEEECcccccccccHHHHHHHHHHcccEEEECccccccccccccEEEEEcccccHHHHHHHHHHHHccccEEcccHHHHHHHHcHHHHHHHHHHHHHHHcccccccccEEEEccccHHHHHHHHHHccccccEEEEccccccccccCEEEEEEcccccccccccEEEEEEEccccEEEEEEEEccEEEEEEEcccccccHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccEEEEEEEEEEccccccEEEEEEcccccccccccHHHHHHHHHHHHHHcccccccccccccccccccc
********YCKIGYVFAPNKEQTVIQPSLITKATEQGIGLIRIDPDKPLTEQGPFDCIMHKLYGPDWTQQLQQFSSRNPDVRIIDPPESIERLHNRDSMLEVVSRLKIELNKEKVSVPNQAVVSETELVTRDMAIEELKLRFPLIAKPLEANGSDKSHQMYLIFDNEGLEVLEAPILLQEFVNHGGIIFKVYVAGSSVKCVKRKSL*************************************MPREGFVVELSRALREALGLNLFNFDLIRDAGERDGYLVIDINYLPGYAKLPGYETLLMDFFLNVAKS*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNHEGQPYCKIGYVFAPNKEQTVIQPSLITKATEQGIGLIRIDPDKPLTEQGPFDCIMHKLYGPDWTQQLQQFSSRNPDVRIIDPPESIERLHNRDSMLEVVSRLKIELNKEKVSVPNQAVVSETELVTRDMAIEELKLRFPLIAKPLEANGSDKSHQMYLIFDNEGLEVLEAPILLQEFVNHGGIIFKVYVAGSSVKCVKRKSLPDISEEKMKSLKGFLPFSQISSNSVDADEEVDLEKTEMPREGFVVELSRALREALGLNLFNFDLIRDAGERDGYLVIDINYLPGYAKLPGYETLLMDFFLNVAKSKAVEEVTSGDELNESVCLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inositol-tetrakisphosphate 1-kinase 1 Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not (By similarity). Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway.probableQ9SBA5
Inositol-tetrakisphosphate 1-kinase 1 Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3 and participates in phytic acid biosynthesis in developing seeds. Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway. Also able to phosphorylate Ins(3,5,6)P3 but not Ins(1,4,5)P3, Ins(2,4,5)P3, Ins(1,3,4,6)P4 nor Ins(1,3,5,6)P4. Has higher specific activity on Ins(3,4,5,6)P4 than Ins(1,3,4)P3 and Ins(3,5,6)P3. Can also could use Ins(1,2,5,6)P4 as a substrate.probableQ84Y01

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.134Transferred entry: 2.7.1.134.probable
2.7.1.159Inositol-1,3,4-trisphosphate 5/6-kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Q7D, chain A
Confidence level:very confident
Coverage over the Query: 6-321
View the alignment between query and template
View the model in PyMOL