BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047775
         (386 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1Z3Q|A Chain A, Resolution Of The Structure Of The Allergenic And
           Antifungal Banana Fruit Thaumatin-Like Protein At 1.7a
          Length = 200

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 21/48 (43%)

Query: 206 AMTTLGKTWAADESQFSAANGKRSLVGDLFGLLSAMSYGLFTVLLKKF 253
           A TT G+ W      F  +   R   GD  G+LS  +YG     L +F
Sbjct: 37  AGTTGGRIWGRTGCSFDGSGRGRCQTGDCGGVLSCTAYGNPPNTLAEF 84


>pdb|1CS1|A Chain A, Cystathionine Gamma-Synthase (Cgs) From Escherichia Coli
 pdb|1CS1|B Chain B, Cystathionine Gamma-Synthase (Cgs) From Escherichia Coli
 pdb|1CS1|C Chain C, Cystathionine Gamma-Synthase (Cgs) From Escherichia Coli
 pdb|1CS1|D Chain D, Cystathionine Gamma-Synthase (Cgs) From Escherichia Coli
          Length = 386

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%)

Query: 335 LGMSLTIPLAMVADMVIHGRHYSAIYILGSAQVFAGFVIVNVSD 378
           L  +L  PLA+ AD+V+H       Y+ G + V AG VI    D
Sbjct: 177 LSPALQNPLALGADLVLHS---CTXYLNGHSDVVAGVVIAKDPD 217


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,431,245
Number of Sequences: 62578
Number of extensions: 326436
Number of successful extensions: 739
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 738
Number of HSP's gapped (non-prelim): 5
length of query: 386
length of database: 14,973,337
effective HSP length: 101
effective length of query: 285
effective length of database: 8,652,959
effective search space: 2466093315
effective search space used: 2466093315
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)