BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047792
         (913 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3O9N|A Chain A, Crystal Structure Of A New Form Of Xylanase-A-Amylase
           Inhibitor Protein(Xaip-Iii) At 2.4 A Resolution
          Length = 272

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 527 GGQVYSLDISRSSYSGVEISAEGIYDSKTGQLCMVGCRSIVSNNLSSTSDSMDCEILL-- 584
           GGQ  +LDIS  S SG+E   +         L  +G  +    +L S SD+ D  + L  
Sbjct: 40  GGQTPALDISGHSPSGLEPQIKHCQSKNVKVLLSIGGPA-GPYSLDSRSDANDLAVYLFN 98

Query: 585 NFQFPPSNPKEN 596
           NF  PP + + N
Sbjct: 99  NFLLPPGHSENN 110


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.134    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,917,438
Number of Sequences: 62578
Number of extensions: 1021924
Number of successful extensions: 1941
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1939
Number of HSP's gapped (non-prelim): 3
length of query: 913
length of database: 14,973,337
effective HSP length: 108
effective length of query: 805
effective length of database: 8,214,913
effective search space: 6613004965
effective search space used: 6613004965
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)