BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 047801
(86 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2IUB|A Chain A, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution.
pdb|2IUB|B Chain B, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution.
pdb|2IUB|C Chain C, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution.
pdb|2IUB|D Chain D, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution.
pdb|2IUB|E Chain E, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution.
pdb|2IUB|F Chain F, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution.
pdb|2IUB|G Chain G, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution.
pdb|2IUB|H Chain H, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution.
pdb|2IUB|I Chain I, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution.
pdb|2IUB|J Chain J, Crystal Structure Of A Divalent Metal Ion Transporter Cora
At 2.9 A Resolution
Length = 363
Score = 28.5 bits (62), Expect = 0.88, Method: Composition-based stats.
Identities = 11/23 (47%), Positives = 18/23 (78%)
Query: 46 PENKWKSAYIIVISVLGGIAVLL 68
PE +WK Y +V++V+G IAV++
Sbjct: 331 PELRWKWGYPVVLAVMGVIAVIM 353
>pdb|2BBJ|A Chain A, Crystal Structure Of The Cora Mg2+ Transporter
pdb|2BBJ|B Chain B, Crystal Structure Of The Cora Mg2+ Transporter
pdb|2BBJ|D Chain D, Crystal Structure Of The Cora Mg2+ Transporter
pdb|2BBJ|E Chain E, Crystal Structure Of The Cora Mg2+ Transporter
pdb|2BBJ|F Chain F, Crystal Structure Of The Cora Mg2+ Transporter
pdb|2HN2|A Chain A, Crystal Structure Of The Cora Mg2+ Transporter Homologue
From T. Maritima In Complex With Divalent Cations
pdb|2HN2|B Chain B, Crystal Structure Of The Cora Mg2+ Transporter Homologue
From T. Maritima In Complex With Divalent Cations
pdb|2HN2|C Chain C, Crystal Structure Of The Cora Mg2+ Transporter Homologue
From T. Maritima In Complex With Divalent Cations
pdb|2HN2|D Chain D, Crystal Structure Of The Cora Mg2+ Transporter Homologue
From T. Maritima In Complex With Divalent Cations
pdb|2HN2|E Chain E, Crystal Structure Of The Cora Mg2+ Transporter Homologue
From T. Maritima In Complex With Divalent Cations
Length = 354
Score = 28.5 bits (62), Expect = 0.89, Method: Composition-based stats.
Identities = 11/23 (47%), Positives = 18/23 (78%)
Query: 46 PENKWKSAYIIVISVLGGIAVLL 68
PE +WK Y +V++V+G IAV++
Sbjct: 322 PELRWKWGYPVVLAVMGVIAVIM 344
>pdb|4EEB|A Chain A, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EEB|B Chain B, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EEB|C Chain C, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EEB|D Chain D, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EEB|E Chain E, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EED|A Chain A, Cora Coiled-Coil Mutant Under Mg2+ Presence
pdb|4EED|B Chain B, Cora Coiled-Coil Mutant Under Mg2+ Presence
pdb|4EED|C Chain C, Cora Coiled-Coil Mutant Under Mg2+ Presence
pdb|4EED|D Chain D, Cora Coiled-Coil Mutant Under Mg2+ Presence
pdb|4EED|E Chain E, Cora Coiled-Coil Mutant Under Mg2+ Presence
Length = 330
Score = 28.5 bits (62), Expect = 0.98, Method: Composition-based stats.
Identities = 11/23 (47%), Positives = 18/23 (78%)
Query: 46 PENKWKSAYIIVISVLGGIAVLL 68
PE +WK Y +V++V+G IAV++
Sbjct: 298 PELRWKWGYPVVLAVMGVIAVIM 320
>pdb|3EZ2|A Chain A, Partition Protein-Adp Complex
pdb|3EZ2|B Chain B, Partition Protein-Adp Complex
pdb|3EZ6|A Chain A, Structure Of Para-Adp Complex:tetragonal Form
pdb|3EZ6|B Chain B, Structure Of Para-Adp Complex:tetragonal Form
Length = 398
Score = 25.8 bits (55), Expect = 5.7, Method: Composition-based stats.
Identities = 12/47 (25%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
Query: 27 YAILVLGIINVFKGLDILNPENKWKSAYIIVISVL-GGIAVLLEAIT 72
YA+ + II++++ + +++ AY+I IS L GG++ + ++
Sbjct: 82 YAMSIQNIIDIYEHRGVPKYRDRYSEAYVIFISNLKGGVSKTVSTVS 128
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.145 0.458
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,675,872
Number of Sequences: 62578
Number of extensions: 93467
Number of successful extensions: 408
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 404
Number of HSP's gapped (non-prelim): 5
length of query: 86
length of database: 14,973,337
effective HSP length: 54
effective length of query: 32
effective length of database: 11,594,125
effective search space: 371012000
effective search space used: 371012000
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)