BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047827
         (104 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2C6X|A Chain A, Structure Of Bacillus Subtilis Citrate Synthase
 pdb|2C6X|B Chain B, Structure Of Bacillus Subtilis Citrate Synthase
 pdb|2C6X|C Chain C, Structure Of Bacillus Subtilis Citrate Synthase
 pdb|2C6X|D Chain D, Structure Of Bacillus Subtilis Citrate Synthase
          Length = 363

 Score = 25.0 bits (53), Expect = 9.7,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 66  PEFQSLLQQAEEEFGFDHDMGLTIPCEEQVFQSL 99
           P  ++L Q+AEE  G D D+ L +  E +  + L
Sbjct: 259 PRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLL 292


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,772,733
Number of Sequences: 62578
Number of extensions: 101709
Number of successful extensions: 179
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 178
Number of HSP's gapped (non-prelim): 1
length of query: 104
length of database: 14,973,337
effective HSP length: 69
effective length of query: 35
effective length of database: 10,655,455
effective search space: 372940925
effective search space used: 372940925
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)