Query         047852
Match_columns 422
No_of_seqs    175 out of 949
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 03:48:38 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/047852.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/047852hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 1.8E-41 3.8E-46  294.3   5.8  123   14-137     1-129 (129)
  2 smart00265 BH4 BH4 Bcl-2 homol  26.7      71  0.0015   21.9   2.5   21   23-43      4-24  (27)
  3 cd00490 Met_repressor_MetJ Met  17.7 1.3E+02  0.0028   26.2   2.9   37   21-61     50-86  (103)
  4 PF01340 MetJ:  Met Apo-repress  17.0 1.4E+02   0.003   26.1   2.9   37   21-61     50-86  (104)
  5 PF02180 BH4:  Bcl-2 homology r  16.1 1.5E+02  0.0032   20.4   2.3   20   24-43      5-24  (27)
  6 PRK05264 transcriptional repre  15.8 1.4E+02  0.0031   26.1   2.7   37   21-61     51-87  (105)
  7 COG3060 MetJ Transcriptional r  12.9 1.3E+02  0.0027   26.1   1.6   37   21-61     51-87  (105)
  8 PHA00692 hypothetical protein   10.9   1E+02  0.0022   25.0   0.4    9   13-21     36-44  (74)
  9 PF07960 CBP4:  CBP4;  InterPro   9.6 1.5E+02  0.0033   27.1   1.1   11   21-31     30-40  (128)
 10 PF08338 DUF1731:  Domain of un   9.2 2.1E+02  0.0046   21.5   1.6   18   14-31     29-47  (48)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=1.8e-41  Score=294.34  Aligned_cols=123  Identities=56%  Similarity=1.166  Sum_probs=95.2

Q ss_pred             CCCCceECCChHHHHHHHHHHHHhCCCCCc-CcceecccCCCCCCCCCC-----CCeeEEecccccccCCCCCCcccccC
Q 047852           14 LLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKYDPWDLPR-----EKEWYFYCPRDRKYRNSARPNRVTGA   87 (422)
Q Consensus        14 LPPGFRF~PTDEELV~~YLrpKI~g~pLp~-~~I~evDVY~~ePWdLp~-----d~eWYFFtpr~rK~~nG~R~~R~tGg   87 (422)
                      |||||||+|||+|||.+||++|+.|.+++. .+|+++|||++|||+|++     +++||||+++++++.++.|.+|++++
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~~~~~~~~~~yFF~~~~~~~~~~~r~~R~~~~   80 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPAKFKGGDEEWYFFSPRKKKYPNGGRPNRVTGG   80 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHHHSSS-SSEEEEEEE----------S-EEETT
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhhhccCCCceEEEEEecccccCCcccccccccc
Confidence            899999999999999999999999999887 799999999999999993     78999999999999999999999999


Q ss_pred             ceeeecCCcccEEcCCCCEEEEEEEEEEeeeccCCCCCccCeEEEEEEcC
Q 047852           88 GFWKATGTDRPIYSSEGNKCIGLKKSLVFYKGKAAKGIKTDWMMHEFRLP  137 (422)
Q Consensus        88 G~WK~tG~~K~I~s~~Gg~vIG~KKtLvFY~Gr~~~g~KT~WvMhEY~L~  137 (422)
                      |+||.+|+.++|.+. ++++||+||+|+||.++.+++.+|+|+||||+|.
T Consensus        81 G~Wk~~g~~~~i~~~-~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   81 GYWKSTGKEKPIKDP-GGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             EEEEEECEEEEEEE--TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             eEEeecccccccccc-cceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            999999999999987 5689999999999998888899999999999983


No 2  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=26.72  E-value=71  Score=21.89  Aligned_cols=21  Identities=29%  Similarity=0.314  Sum_probs=17.1

Q ss_pred             ChHHHHHHHHHHHHhCCCCCc
Q 047852           23 TDEELVGFYLKRKIQQRPLSI   43 (422)
Q Consensus        23 TDEELV~~YLrpKI~g~pLp~   43 (422)
                      .-.|||.+|+.-|+..+..++
T Consensus         4 ~nRelV~~yv~yKLsQrgy~w   24 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGYEW   24 (27)
T ss_pred             chHHHHHHHHHHHHhhcCCCC
Confidence            457999999999998776554


No 3  
>cd00490 Met_repressor_MetJ Met Repressor, MetJ.  MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine.  MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence.  MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Probab=17.67  E-value=1.3e+02  Score=26.21  Aligned_cols=37  Identities=24%  Similarity=0.331  Sum_probs=30.1

Q ss_pred             CCChHHHHHHHHHHHHhCCCCCcCcceecccCCCCCCCCCC
Q 047852           21 HPTDEELVGFYLKRKIQQRPLSIELIKQLDIYKYDPWDLPR   61 (422)
Q Consensus        21 ~PTDEELV~~YLrpKI~g~pLp~~~I~evDVY~~ePWdLp~   61 (422)
                      |-|..||+..-...-..|+|||.    +.|+-+..|.++|+
T Consensus        50 HATNSELLCEAFLHAfTGQPLP~----D~Dl~K~~~d~iP~   86 (103)
T cd00490          50 HATNSELLCEAFLHAFTGQPLPD----DADLRKERSDEIPE   86 (103)
T ss_pred             hcccHHHHHHHHHHHhcCCCCCC----hhhhhhcCcccccH
Confidence            56778888776677779999997    66888888988885


No 4  
>PF01340 MetJ:  Met Apo-repressor, MetJ;  InterPro: IPR002084 Binding of a specific DNA fragment and S-adenosyl methionine (SAM) co-repressor molecules to the Escherichia coli methionine repressor (MetJ) leads to a significant reduction in dynamic flexibility of the ternary complex, with considerable entropy-enthalpy compensation, not necessarily involving any overall conformational change []. MetJ is a regulatory protein which when combined with S-adenosylmethionine (SAM) represses the expression of the methionine regulon and of enzymes involved in SAM synthesis. It is also autoregulated. The crystal structure of the met repressor-operator complex shows two dimeric repressor molecules bound to adjacent sites 8 base pairs apart on an 18-base-pair DNA fragment. Sequence specificity is achieved by insertion of double-stranded antiparallel protein beta-ribbons into the major groove of B-form DNA, with direct hydrogen-bonding between amino-acid side chains and the base pairs. The repressor also recognises sequence-dependent distortion or flexibility of the operator phosphate backbone, conferring specificity even for inaccessible base pairs [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0006555 methionine metabolic process; PDB: 1MJO_D 1CMB_A 1MJQ_C 1CMC_B 1MJK_A 1MJ2_A 1MJP_A 1MJM_B 1CMA_B 1MJL_A ....
Probab=16.95  E-value=1.4e+02  Score=26.12  Aligned_cols=37  Identities=27%  Similarity=0.390  Sum_probs=23.1

Q ss_pred             CCChHHHHHHHHHHHHhCCCCCcCcceecccCCCCCCCCCC
Q 047852           21 HPTDEELVGFYLKRKIQQRPLSIELIKQLDIYKYDPWDLPR   61 (422)
Q Consensus        21 ~PTDEELV~~YLrpKI~g~pLp~~~I~evDVY~~ePWdLp~   61 (422)
                      |-|..||+..-...-..|+|||.    +.|+-+..|.++|.
T Consensus        50 HATNSeLLcEAFLHAfTGQPLP~----D~dl~kd~~d~ip~   86 (104)
T PF01340_consen   50 HATNSELLCEAFLHAFTGQPLPT----DDDLRKDRPDEIPA   86 (104)
T ss_dssp             S-SHHHHHHHHHHHHHH----------TTGGGSTSGSSS-H
T ss_pred             hcccHHHHHHHHHHHhcCCCCCC----hhhhhhcCCccchH
Confidence            56888888776777779999997    66888888988885


No 5  
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=16.13  E-value=1.5e+02  Score=20.44  Aligned_cols=20  Identities=35%  Similarity=0.441  Sum_probs=16.5

Q ss_pred             hHHHHHHHHHHHHhCCCCCc
Q 047852           24 DEELVGFYLKRKIQQRPLSI   43 (422)
Q Consensus        24 DEELV~~YLrpKI~g~pLp~   43 (422)
                      -.|||.+|+.-|+..+..++
T Consensus         5 nR~lV~~yi~yKLsQrgy~w   24 (27)
T PF02180_consen    5 NRELVEDYISYKLSQRGYVW   24 (27)
T ss_dssp             HHHHHHHHHHHHHHHTTSTS
T ss_pred             HHHHHHHHHHHHhhhcCCCC
Confidence            47999999999998776654


No 6  
>PRK05264 transcriptional repressor protein MetJ; Provisional
Probab=15.82  E-value=1.4e+02  Score=26.12  Aligned_cols=37  Identities=24%  Similarity=0.317  Sum_probs=30.0

Q ss_pred             CCChHHHHHHHHHHHHhCCCCCcCcceecccCCCCCCCCCC
Q 047852           21 HPTDEELVGFYLKRKIQQRPLSIELIKQLDIYKYDPWDLPR   61 (422)
Q Consensus        21 ~PTDEELV~~YLrpKI~g~pLp~~~I~evDVY~~ePWdLp~   61 (422)
                      |-|..||+..-...-..|+|||.    +.|+-+..|.++|+
T Consensus        51 HATNSELLCEAFLHA~TGQPLP~----D~Dl~Kd~~d~ip~   87 (105)
T PRK05264         51 HATNSELLCEAFLHAFTGQPLPD----DEDLRKERSDEIPE   87 (105)
T ss_pred             hcccHHHHHHHHHHHHcCCCCCC----hhhhhhcCcccchH
Confidence            56778888776677778999997    66888888988885


No 7  
>COG3060 MetJ Transcriptional regulator of met regulon [Transcription / Amino acid transport and metabolism]
Probab=12.93  E-value=1.3e+02  Score=26.13  Aligned_cols=37  Identities=24%  Similarity=0.360  Sum_probs=29.5

Q ss_pred             CCChHHHHHHHHHHHHhCCCCCcCcceecccCCCCCCCCCC
Q 047852           21 HPTDEELVGFYLKRKIQQRPLSIELIKQLDIYKYDPWDLPR   61 (422)
Q Consensus        21 ~PTDEELV~~YLrpKI~g~pLp~~~I~evDVY~~ePWdLp~   61 (422)
                      |-|..||+..-...-..|+|||.    +.|+.+.-|.++|+
T Consensus        51 hatnsellceaflhaftgqplpt----d~dl~ker~deipe   87 (105)
T COG3060          51 HATNSELLCEAFLHAFTGQPLPT----DADLRKERSDEIPE   87 (105)
T ss_pred             hhhhHHHHHHHHHHHHcCCCCCC----cHHHHHhccccchH
Confidence            56777888776667778999997    67888888888885


No 8  
>PHA00692 hypothetical protein
Probab=10.92  E-value=1e+02  Score=25.01  Aligned_cols=9  Identities=56%  Similarity=0.980  Sum_probs=7.4

Q ss_pred             CCCCCceEC
Q 047852           13 ILLPGFRFH   21 (422)
Q Consensus        13 ~LPPGFRF~   21 (422)
                      ..||||||-
T Consensus        36 eyppgfrfg   44 (74)
T PHA00692         36 EYPPGFRFG   44 (74)
T ss_pred             ecCCCcccc
Confidence            478999995


No 9  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=9.63  E-value=1.5e+02  Score=27.07  Aligned_cols=11  Identities=55%  Similarity=0.827  Sum_probs=9.5

Q ss_pred             CCChHHHHHHH
Q 047852           21 HPTDEELVGFY   31 (422)
Q Consensus        21 ~PTDEELV~~Y   31 (422)
                      .||||||+..|
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            49999999875


No 10 
>PF08338 DUF1731:  Domain of unknown function (DUF1731);  InterPro: IPR013549 This domain of unknown function appears towards the C terminus of proteins of the NAD dependent epimerase/dehydratase family (IPR001509 from INTERPRO) in bacteria, eukaryotes and archaea. Many of the proteins in which it is found are involved in cell-division inhibition. ; PDB: 3OH8_A.
Probab=9.25  E-value=2.1e+02  Score=21.52  Aligned_cols=18  Identities=44%  Similarity=0.604  Sum_probs=10.5

Q ss_pred             CCCCceEC-CChHHHHHHH
Q 047852           14 LLPGFRFH-PTDEELVGFY   31 (422)
Q Consensus        14 LPPGFRF~-PTDEELV~~Y   31 (422)
                      +--||+|+ |+=++.+.+-
T Consensus        29 ~~~GF~F~~p~l~~AL~~l   47 (48)
T PF08338_consen   29 LEAGFQFRYPTLEEALRDL   47 (48)
T ss_dssp             HHTT---S-SSHHHHHHH-
T ss_pred             HHCCCcccCCCHHHHHhcc
Confidence            33699998 8888887763


Done!