Citrus Sinensis ID: 047891

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MALTLRSSTSFINLNDTKTIKTPDEFSSPTTCFAKIKPSRRLRAKSSMQEAQLCRDKHSTMGGIIRKSEKREMVHELASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKDGPLNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRERFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASGNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYRDGYIPIARMLAKHGVILNFTCMEMRDTEQPGNANCSPEGLVRQVKMATRTAGVELAGENALERYDADAYAQVLATSNLDAGNGLSAFTYLRMNKKLFMSDNWRNLVEFVQRMSSEGRRPRLPEWDSTGSDLCVGFVKGKNGTKTKEAALV
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHccccccccccccccccEEEEccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccHHHHHHHHHHHcccEEEEEEEEccccccccccccccccHHHHHHHcccccEEEEccccccccccECccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEECcCEECccccccccccccccccccccccccHHHHHHHHHcccEEEEECcccccccccccccccHHHHHHHHHHHHHHccccEEcccccccccHHHHHHHHHHccccccccEEEEEEEcccccccccccHHHHHHHHHHHccccccccccccccccccEEEccccccccccccccccc
****************************************************************************************VPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKDGPLNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRERFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASGNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYRDGYIPIARMLAKHGVILNFTCMEMRDTE*******SPEGLVRQVKMATRTAGVELAGENALERYDADAYAQVLATSNLDAGNGLSAFTYLRMNKKLFMSDNWRNLVEFVQRMSSE**************DLCVGFV**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALTLRSSTSFINLNDTKTIKTPDEFSSPTTCFAKIKPSRRLRAKSSMQEAQLCRDKHSTMGGIIRKSEKREMVHELASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKDGPLNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRERFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEASGNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYRDGYIPIARMLAKHGVILNFTCMEMRDTEQPGNANCSPEGLVRQVKMATRTAGVELAGENALERYDADAYAQVLATSNLDAGNGLSAFTYLRMNKKLFMSDNWRNLVEFVQRMSSEGRRPRLPEWDSTGSDLCVGFVKGKNGTKTKEAALV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-amylase 3, chloroplastic Beta-amylase activity. No alpha-amylase activity. Involved in cold resistance. Mediates the accumulation of maltose upon freezing stress, thus contributing to the protection of the photosynthetic electron transport chain. Plays a role in the circadian-regulated starch degradation and maltose metabolism in chloroplasts, especially at night. More active on phosphorylated glucan. Interacts directly with starch or other alpha-1,4-glucan.confidentO23553

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.2Beta-amylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FA2, chain A
Confidence level:very confident
Coverage over the Query: 86-518
View the alignment between query and template
View the model in PyMOL
Template: 1VEM, chain A
Confidence level:very confident
Coverage over the Query: 87-539
View the alignment between query and template
View the model in PyMOL