BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 047958
         (103 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2D2X|A Chain A, Crystal Structure Of 2-Deoxy-Scyllo-Inosose Synthase
 pdb|2D2X|B Chain B, Crystal Structure Of 2-Deoxy-Scyllo-Inosose Synthase
 pdb|2GRU|A Chain A, Crystal Structure Of 2-Deoxy-Scyllo-Inosose Synthase
           Complexed With Carbaglucose-6-Phosphate, Nad+ And Co2+
 pdb|2GRU|B Chain B, Crystal Structure Of 2-Deoxy-Scyllo-Inosose Synthase
           Complexed With Carbaglucose-6-Phosphate, Nad+ And Co2+
          Length = 368

 Score = 26.9 bits (58), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%)

Query: 19  VKLRQQIQMLQNSNKHLMRDSLSSLTVKELKQLENRHEF 57
            +L + + +L+N NK    D L+S  V   KQLE    F
Sbjct: 182 CELVKNMLILENDNKEFTEDDLNSANVYSPKQLETFINF 220


>pdb|1EDG|A Chain A, Single Crystal Structure Determination Of The Catalytic
           Domain Of Celcca Carried Out At 15 Degree C
          Length = 380

 Score = 25.8 bits (55), Expect = 7.4,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 70  AIHALASQNFFGPAIIEGGGSAYSHPDKK 98
           ++HA    NF G A+ +GG +A++  D K
Sbjct: 252 SVHAYCPWNFAGLAMADGGTNAWNINDSK 280


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.126    0.337 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,616,443
Number of Sequences: 62578
Number of extensions: 78829
Number of successful extensions: 109
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 107
Number of HSP's gapped (non-prelim): 2
length of query: 103
length of database: 14,973,337
effective HSP length: 68
effective length of query: 35
effective length of database: 10,718,033
effective search space: 375131155
effective search space used: 375131155
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)