Citrus Sinensis ID: 047978


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MALLGKFQETQRPQANPANCVYQTDYPDFYFRITSSNHMTELKEKFKRMYILVPKVPKLGKEAVSKAIKEWGQPISKITHLISCSVSGVDMPGADYQLTKLLGLKPSVKRVMLTAESNAGARVLVVCSEITVGTFRAPSDENLSCLVNRAIVGDGTAALIVGACPDINTERPLFHIVPTAQTILPDSEDAIKGHFRESPLIADNIDKFLAESFDQVSLNDHDWNSLFWMMHPIGPAVLDQIEGKLGLEKTKLRETRHVLSEYGNMASATVLFVLDEMRKRSVEEGKATTGEELEWGVLLGFEAGLTVEAIVLRSIPMVSN
ccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccccEEEEEECcccccccHHHHHHHHcccccccHHHHHHcccccccEEEEEEEEccccccccccccccHHHHHHcccccccEEEEEEccccccccccccccccccEEEcccccccCEEEEEcccccHHHHHHHHHHHHHcccccccccccccEEEccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEEcHHHHHHHHHHHccccccc
**L*GKFQETQRPQANPANCVYQTDYPDFYFRITSSNHMTELKEKFKRMYILVPKVPKLGKEAVSKAIKEWGQPISKITHLISCSVSGVDMPGADYQLTKLLGLKPSVKRVMLTAESNAGARVLVVCSEITVGTFRAPSDENLSCLVNRAIVGDGTAALIVGACPDINTERPLFHIVPTAQTILPDSEDAIKGHFRESPLIADNIDKFLAESFDQVSLNDHDWNSLFWMMHPIGPAVLDQIEGKLGLEKTKLRETRHVLSEYGNMASATVLFVLDEMR*********TTGEELEWGVLLGFEAGLTVEAIVLRSIPM***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLGKFQETQRPQANPANCVYQTDYPDFYFRITSSNHMTELKEKFKRMYILVPKVPKLGKEAVSKAIKEWGQPISKITHLISCSVSGVDMPGADYQLTKLLGLKPSVKRVMLTAESNAGARVLVVCSEITVGTFRAPSDENLSCLVNRAIVGDGTAALIVGACPDINTERPLFHIVPTAQTILPDSEDAIKGHFRESPLIADNIDKFLAESFDQVSLNDHDWNSLFWMMHPIGPAVLDQIEGKLGLEKTKLRETRHVLSEYGNMASATVLFVLDEMRKRSVEEGKATTGEELEWGVLLGFEAGLTVEAIVLRSIPMVSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chalcone synthase 1 The primary product of this enzyme is 4,2',4',6'-tetrahydroxychalcone (also termed naringenin-chalcone or chalcone) which can under specific conditions spontaneously isomerize into naringenin.probableQ2R3A1
Chalcone synthase The primary product of this enzyme is 4,2',4',6'-tetrahydroxychalcone (also termed naringenin-chalcone or chalcone) which can under specific conditions spontaneously isomerize into naringenin.probableP51090
Chalcone synthase The primary product of this enzyme is 4,2',4',6'-tetrahydroxychalcone (also termed naringenin-chalcone or chalcone) which can under specific conditions spontaneously isomerize into naringenin.probableP13114

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TSY, chain A
Confidence level:very confident
Coverage over the Query: 5-319
View the alignment between query and template
View the model in PyMOL