Query 047994 Match_columns 101 No_of_seqs 20 out of 22 Neff 2.9 Searched_HMMs 46136 Date Fri Mar 29 05:15:32 2013 Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/047994.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/047994hhsearch_cdd -cpu 12 -v 0 No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF03208 PRA1: PRA1 family pro 99.2 1.6E-11 3.5E-16 86.4 3.9 50 49-100 5-54 (153) 2 KOG3142 Prenylated rab accepto 97.4 0.00015 3.2E-09 56.0 3.8 43 53-97 38-80 (187) 3 COG5130 YIP3 Prenylated rab ac 93.2 0.11 2.3E-06 40.3 3.4 40 56-96 32-71 (169) 4 PF03374 ANT: Phage antirepres 45.2 12 0.00026 24.9 1.1 20 10-29 34-53 (111) 5 PF15178 TOM_sub5: Mitochondri 43.6 34 0.00073 22.1 2.9 27 71-97 12-38 (51) 6 PF14664 RICTOR_N: Rapamycin-i 41.8 21 0.00045 29.6 2.2 52 48-99 268-331 (371) 7 COG5144 TFB2 RNA polymerase II 37.9 13 0.00028 32.5 0.5 24 1-28 50-73 (447) 8 TIGR03687 pupylate_cterm ubiqu 35.0 27 0.00059 20.8 1.4 15 77-91 14-28 (33) 9 PF10092 DUF2330: Uncharacteri 34.8 20 0.00044 30.1 1.2 12 15-26 139-150 (348) 10 TIGR02742 TrbC_Ftype type-F co 32.3 24 0.00053 25.6 1.1 18 8-25 5-22 (130) 11 PF09673 TrbC_Ftype: Type-F co 32.3 25 0.00054 24.4 1.1 17 8-24 4-20 (113) 12 PF09921 DUF2153: Uncharacteri 30.5 25 0.00053 26.3 0.9 9 15-23 47-55 (126) 13 COG3645 Uncharacterized phage- 30.4 25 0.00054 26.4 0.9 21 10-30 57-77 (135) 14 PF12959 DUF3848: Protein of u 29.5 21 0.00045 25.7 0.3 30 4-38 62-92 (101) 15 PF11639 HapK: REDY-like prote 29.4 23 0.0005 25.6 0.6 18 11-28 13-30 (104) 16 KOG4050 Glutamate transporter 29.2 48 0.001 26.3 2.3 47 52-99 19-67 (188) 17 PF08260 Kinin: Insect kinin p 29.1 12 0.00027 16.2 -0.5 7 14-20 1-7 (8) 18 PF10905 DUF2695: Protein of u 27.5 39 0.00084 21.5 1.3 15 11-25 29-43 (53) 19 PF12415 rpo132: Poxvirus DNA 26.3 42 0.00091 19.8 1.2 33 58-90 1-33 (33) 20 PLN02999 photosystem II oxygen 26.1 75 0.0016 25.3 2.9 38 56-94 71-122 (190) 21 PRK10699 phosphatidylglyceroph 22.6 40 0.00087 26.9 0.8 25 51-75 142-166 (244) 22 KOG3471 RNA polymerase II tran 22.4 41 0.00089 29.9 0.9 28 1-32 57-84 (465) 23 PF01277 Oleosin: Oleosin; In 21.8 83 0.0018 23.0 2.3 24 67-90 88-114 (118) No 1 >PF03208 PRA1: PRA1 family protein; InterPro: IPR004895 This family includes yeast hypothetical proteins and the uncharacterised rat prenylated rab acceptor protein PRA1. Probab=99.19 E-value=1.6e-11 Score=86.39 Aligned_cols=50 Identities=32% Similarity=0.606 Sum_probs=46.2 Q ss_pred cCCCCCcchhhhcccccccCCCChhhhhhhhhhhHHHHhhhhHHhHhhhhhc Q 047994 49 TATTPSWTREFIGALRSYSFPSSPHTLKLRVHENVKRYARNYASLFILFFAC 100 (101) Q Consensus 49 ~~~t~~WtreF~g~~~SYSfP~s~~qarlRv~eNvkrY~rNYa~l~i~~Fac 100 (101) ..+..|| +||+ ..++||.|++..|++.|+..|+..|..||+.++++++++ T Consensus 5 ~~~~Rpw-~eF~-~~~~fs~P~~~~~~~~Ri~~Nl~~F~~NY~~i~~~~~~~ 54 (153) T PF03208_consen 5 LSPLRPW-REFF-DTSRFSVPSSFSEAKSRIKRNLSYFQTNYLLIFLLLFLI 54 (153) T ss_pred cCCCCCH-HHHh-CccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Confidence 3577899 8999 788999999999999999999999999999999998876 No 2 >KOG3142 consensus Prenylated rab acceptor 1 [Intracellular trafficking, secretion, and vesicular transport] Probab=97.44 E-value=0.00015 Score=56.04 Aligned_cols=43 Identities=23% Similarity=0.509 Sum_probs=37.5 Q ss_pred CCcchhhhcccccccCCCChhhhhhhhhhhHHHHhhhhHHhHhhh Q 047994 53 PSWTREFIGALRSYSFPSSPHTLKLRVHENVKRYARNYASLFILF 97 (101) Q Consensus 53 ~~WtreF~g~~~SYSfP~s~~qarlRv~eNvkrY~rNYa~l~i~~ 97 (101) .|| +||+.. .+.|.|+|..+|..|+--|+..|--||+.++.++ T Consensus 38 RpW-~ef~d~-~~fs~P~s~s~a~sRi~~Nl~yF~~NY~~iv~~~ 80 (187) T KOG3142|consen 38 RPW-SEFFDR-SAFSRPRSLSDATSRIKRNLSYFRVNYVIIVAIL 80 (187) T ss_pred CCH-HHHHcc-cccCCCccHHHHHHHHHHHHHHHHHhHHHHHHHH Confidence 459 799954 6789999999999999999999999999877543 No 3 >COG5130 YIP3 Prenylated rab acceptor 1 and related proteins [Intracellular trafficking and secretion / Signal transduction mechanisms] Probab=93.20 E-value=0.11 Score=40.27 Aligned_cols=40 Identities=30% Similarity=0.515 Sum_probs=33.9 Q ss_pred chhhhcccccccCCCChhhhhhhhhhhHHHHhhhhHHhHhh Q 047994 56 TREFIGALRSYSFPSSPHTLKLRVHENVKRYARNYASLFIL 96 (101) Q Consensus 56 treF~g~~~SYSfP~s~~qarlRv~eNvkrY~rNYa~l~i~ 96 (101) +||||.-. --|-|....||+.||--|++|+--||..+..+ T Consensus 32 ~~eFfni~-rIs~PqNf~eaqsRv~~Nl~rFssnYlaiia~ 71 (169) T COG5130 32 TREFFNIG-RISVPQNFNEAQSRVFANLDRFSSNYLAIIAI 71 (169) T ss_pred HHHHhccc-cccCCcchHHHHHHHHhhHHHHhhhHHHHHHH Confidence 48999643 35889999999999999999999999876543 No 4 >PF03374 ANT: Phage antirepressor protein KilAC domain; InterPro: IPR005039 This entry is represented by Bacteriophage P1, Ant1 C-terminal domain, which represents the processed Ant2 chain. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. Prophages P1 and P7 exist as unit copy DNA plasmids in the bacterial cell. Maintenance of the prophage state requires the continuous expression of two repressors: (i) C1 is a protein which negatively regulates the expression of lytic genes including the C1 inactivator gene coi, and (ii) C4 is an antisense RNA which specifically inhibits the synthesis of an anti-repressor Ant.; GO: 0003677 DNA binding Probab=45.19 E-value=12 Score=24.86 Aligned_cols=20 Identities=25% Similarity=0.529 Sum_probs=17.6 Q ss_pred cccCchHHHHhhhhcchhhH Q 047994 10 LNVPDPAFESWLRDSSYLEI 29 (101) Q Consensus 10 Lsvp~~afe~WlrDsg~le~ 29 (101) |.+++..|-+||||.|++-. T Consensus 34 L~i~~~~l~~~Lr~~g~l~~ 53 (111) T PF03374_consen 34 LGIGRNKLFQWLREKGWLYR 53 (111) T ss_pred hCCCHHHHHHHHHhCCceEE Confidence 57889999999999998865 No 5 >PF15178 TOM_sub5: Mitochondrial import receptor subunit TOM5 homolog Probab=43.63 E-value=34 Score=22.14 Aligned_cols=27 Identities=26% Similarity=0.471 Sum_probs=24.0 Q ss_pred ChhhhhhhhhhhHHHHhhhhHHhHhhh Q 047994 71 SPHTLKLRVHENVKRYARNYASLFILF 97 (101) Q Consensus 71 s~~qarlRv~eNvkrY~rNYa~l~i~~ 97 (101) .+.|.|.||.+.|---.||++..+.+. T Consensus 12 DPeE~k~kmR~dvissvrnFliyVALl 38 (51) T PF15178_consen 12 DPEEMKRKMREDVISSVRNFLIYVALL 38 (51) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHH Confidence 578999999999999999999887764 No 6 >PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Probab=41.84 E-value=21 Score=29.64 Aligned_cols=52 Identities=19% Similarity=0.385 Sum_probs=32.0 Q ss_pred ccCCCCCcchhhhcccccccCCCChhhhhhh---------hh---hhHHHHhhhhHHhHhhhhh Q 047994 48 ETATTPSWTREFIGALRSYSFPSSPHTLKLR---------VH---ENVKRYARNYASLFILFFA 99 (101) Q Consensus 48 l~~~t~~WtreF~g~~~SYSfP~s~~qarlR---------v~---eNvkrY~rNYa~l~i~~Fa 99 (101) |.-++|+|+.+|....+.-.+.+...+++++ +. ++-...+.||.+|.+.+|. T Consensus 268 lrik~p~w~~~~~~~~~~~~~~~~~~~~~l~~~~~e~~~~~~~~~~~~~~l~~~y~aLll~ili 331 (371) T PF14664_consen 268 LRIKPPSWTESFLAGRRLTTYGRFQDTWNLSSGFAEAKSILPHRSSKRPNLVNHYLALLLAILI 331 (371) T ss_pred HCCCCCCcccchhhcccccccccccchhhhcccccccccccCccccccccHHHHHHHHHHHHHH Confidence 4567889999999644444444332223332 11 1344678899999888774 No 7 >COG5144 TFB2 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB2 [Transcription / DNA replication, recombination, and repair] Probab=37.86 E-value=13 Score=32.45 Aligned_cols=24 Identities=25% Similarity=0.556 Sum_probs=19.2 Q ss_pred CCccCCCcccccCchHHHHhhhhcchhh Q 047994 1 MVFASNPLSLNVPDPAFESWLRDSSYLE 28 (101) Q Consensus 1 M~F~~NPLSLsvp~~afe~WlrDsg~le 28 (101) |.|.+||.||+ +++.|++.++-+- T Consensus 50 mlfn~~~v~ll----d~d~wik~~~Ki~ 73 (447) T COG5144 50 MLFNSHSVSLL----DEDEWIKETLKIL 73 (447) T ss_pred HHcCCCCcchh----hHHHHHhhhhHHH Confidence 67888887775 8999999998443 No 8 >TIGR03687 pupylate_cterm ubiquitin-like protein Pup. Members of this protein family are Pup, a small protein whose ligation to target proteins steers them toward degradation. This protein family occurs in a number of bacteria, especially Actinobacteria such as Mycobacterium tuberculosis, that possess an archeal-type proteasome. All members of this protein family known during model construction end with the C-terminal motif [FY][VI]QKGG[QE]. Ligation is thought to occur between the C-terminal COOH of Pup and an epsilon-amino group of a Lys on the target protein. The N-terminal half of this protein is poorly conserved and not represented in the seed alignment. Probab=34.96 E-value=27 Score=20.83 Aligned_cols=15 Identities=13% Similarity=0.379 Sum_probs=12.5 Q ss_pred hhhhhhHHHHhhhhH Q 047994 77 LRVHENVKRYARNYA 91 (101) Q Consensus 77 lRv~eNvkrY~rNYa 91 (101) -=+.+|+..|+|+|+ T Consensus 14 ~vLe~NAe~FV~~fV 28 (33) T TIGR03687 14 GVLESNAEEFVRGFV 28 (33) T ss_pred HHHHHhHHHHHHHHH Confidence 346889999999996 No 9 >PF10092 DUF2330: Uncharacterized protein conserved in bacteria (DUF2330); InterPro: IPR019283 Members of this family of hypothetical bacterial proteins have no known function. Probab=34.84 E-value=20 Score=30.10 Aligned_cols=12 Identities=42% Similarity=1.121 Sum_probs=10.8 Q ss_pred hHHHHhhhhcch Q 047994 15 PAFESWLRDSSY 26 (101) Q Consensus 15 ~afe~WlrDsg~ 26 (101) .++++||+|+|| T Consensus 139 ~gL~~WL~~ngY 150 (348) T PF10092_consen 139 DGLRTWLRDNGY 150 (348) T ss_pred HHHHHHHHHcCC Confidence 579999999997 No 10 >TIGR02742 TrbC_Ftype type-F conjugative transfer system pilin assembly protein TrbC. This protein is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA. The N-terminal portion of these proteins are heterogeneous and are not covered by this model. Probab=32.31 E-value=24 Score=25.60 Aligned_cols=18 Identities=22% Similarity=0.626 Sum_probs=16.0 Q ss_pred cccccCchHHHHhhhhcc Q 047994 8 LSLNVPDPAFESWLRDSS 25 (101) Q Consensus 8 LSLsvp~~afe~WlrDsg 25 (101) .|+|.|++.+.++++|.. T Consensus 5 vS~SMP~~~Lk~l~~~a~ 22 (130) T TIGR02742 5 VSFSMPEPLLKQLLDQAE 22 (130) T ss_pred EEcCCCHHHHHHHHHHHH Confidence 489999999999999953 No 11 >PF09673 TrbC_Ftype: Type-F conjugative transfer system pilin assembly protein; InterPro: IPR019106 This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system (aka type 4 secretion system) for the transfer of plasmid DNA [, ]. The N-terminal portion of these proteins is heterogeneous. Probab=32.30 E-value=25 Score=24.37 Aligned_cols=17 Identities=24% Similarity=0.657 Sum_probs=15.4 Q ss_pred cccccCchHHHHhhhhc Q 047994 8 LSLNVPDPAFESWLRDS 24 (101) Q Consensus 8 LSLsvp~~afe~WlrDs 24 (101) .|+|+|++++.++++|. T Consensus 4 vS~SMP~~~L~~l~~~a 20 (113) T PF09673_consen 4 VSFSMPDASLRNLLKQA 20 (113) T ss_pred EECCCCHHHHHHHHHHH Confidence 48999999999999984 No 12 >PF09921 DUF2153: Uncharacterized protein conserved in archaea (DUF2153); InterPro: IPR014450 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function. Probab=30.51 E-value=25 Score=26.32 Aligned_cols=9 Identities=56% Similarity=1.335 Sum_probs=8.2 Q ss_pred hHHHHhhhh Q 047994 15 PAFESWLRD 23 (101) Q Consensus 15 ~afe~WlrD 23 (101) .|||+||.| T Consensus 47 KaFd~WLqd 55 (126) T PF09921_consen 47 KAFDQWLQD 55 (126) T ss_pred HHHHHHHcC Confidence 589999999 No 13 >COG3645 Uncharacterized phage-encoded protein [Function unknown] Probab=30.43 E-value=25 Score=26.45 Aligned_cols=21 Identities=29% Similarity=0.605 Sum_probs=17.1 Q ss_pred cccCchHHHHhhhhcchhhHh Q 047994 10 LNVPDPAFESWLRDSSYLEIL 30 (101) Q Consensus 10 Lsvp~~afe~WlrDsg~le~~ 30 (101) |.+.+..|-.|||++||+=.. T Consensus 57 lkige~~l~~~L~e~~~l~~~ 77 (135) T COG3645 57 LKIGENRLFAWLRENKYLIKR 77 (135) T ss_pred HccCHHHHHHHHHHCCEEEEc Confidence 346788899999999998655 No 14 >PF12959 DUF3848: Protein of unknown function (DUF3848); InterPro: IPR024380 This domain is found in a family of uncharacterised proteins found by clustering human gut metagenomic sequences[]. Probab=29.49 E-value=21 Score=25.74 Aligned_cols=30 Identities=17% Similarity=0.485 Sum_probs=21.7 Q ss_pred cCCCcccccCchHHHHhh-hhcchhhHhhhhccccc Q 047994 4 ASNPLSLNVPDPAFESWL-RDSSYLEILDTATTTSA 38 (101) Q Consensus 4 ~~NPLSLsvp~~afe~Wl-rDsg~le~~d~~~s~~a 38 (101) +++|| +.-+..|+ +|+||++.|-.+..+.+ T Consensus 62 sp~PL-----~~iY~~w~~~et~~mD~ird~i~~~A 92 (101) T PF12959_consen 62 SPSPL-----ADIYREWEKKETSHMDEIRDTIEDRA 92 (101) T ss_pred CCChH-----HHHHHHHHhcccchHHHHHHHHHHHH Confidence 46666 35689999 78999999877654433 No 15 >PF11639 HapK: REDY-like protein HapK; InterPro: IPR021667 This family of proteins represents HapK, a protein of unknown function, with two homologues PigK and RedY. The monomer structure of the protein contains a four-stranded anti parallel beta-sheet, three alpha-helices and a short C-terminal tail which it uses for dimer formation []. The surface of HapK has a deep cavity with consists of a kinked helix and a beta-four strand. HapK could be involved in prodigiosin biosynthesis, specifically the binding of a bipyrrole intermediate such as HBM or MBM []. ; PDB: 2JDJ_B. Probab=29.44 E-value=23 Score=25.64 Aligned_cols=18 Identities=39% Similarity=0.857 Sum_probs=14.6 Q ss_pred ccCchHHHHhhhhcchhh Q 047994 11 NVPDPAFESWLRDSSYLE 28 (101) Q Consensus 11 svp~~afe~WlrDsg~le 28 (101) .+...+||.|+|++-|-- T Consensus 13 gv~~~~fe~Wv~~tDy~t 30 (104) T PF11639_consen 13 GVDPAAFERWVRETDYPT 30 (104) T ss_dssp GGGHHHHHHHHHHTHHHH T ss_pred CCCHHHHHHHHHhcchhc Confidence 467789999999987653 No 16 >KOG4050 consensus Glutamate transporter EAAC1-interacting protein GTRAP3-18 [Amino acid transport and metabolism; Signal transduction mechanisms] Probab=29.24 E-value=48 Score=26.28 Aligned_cols=47 Identities=23% Similarity=0.350 Sum_probs=36.1 Q ss_pred CCCcchhhhcccccccCCC--ChhhhhhhhhhhHHHHhhhhHHhHhhhhh Q 047994 52 TPSWTREFIGALRSYSFPS--SPHTLKLRVHENVKRYARNYASLFILFFA 99 (101) Q Consensus 52 t~~WtreF~g~~~SYSfP~--s~~qarlRv~eNvkrY~rNYa~l~i~~Fa 99 (101) ---| .+|+-.++-|.=|. .+..=--||-.|+--|--||...||..|+ T Consensus 19 lRa~-ddF~lgS~Rfa~Pd~~D~~kW~nRVisNLLYyQTNYfv~~it~~~ 67 (188) T KOG4050|consen 19 LRAL-DDFLLGSDRFARPDFNDFKKWNNRVISNLLYYQTNYFVTFITLFL 67 (188) T ss_pred chhH-HHhccCcccccCCCCccHHHHHHHHHHHHHHHHHhHHHHHHHHHH Confidence 3456 57776667777664 44555579999999999999999998775 No 17 >PF08260 Kinin: Insect kinin peptide; InterPro: IPR013202 This entry represents neuropeptides that are the first members of the insect kinin-family isolated from the American cockroach. Their occurrence in the retrocerebral complex suggests a physiological role as a neurohormone. The C-terminal sequence Phe-X-Ser-Trp-Gly-NH2 characterised the peptides as members of the insect kinin family. Data suggest a possible involvement of insect kinins in water-balance by regulating the osmoregulation. Insect kinins also mediate visceral muscle contractile activity (myotropic activity) []. These peptides have lengths ranging from 6 to 14 amino acids []. Probab=29.07 E-value=12 Score=16.24 Aligned_cols=7 Identities=86% Similarity=1.853 Sum_probs=4.5 Q ss_pred chHHHHh Q 047994 14 DPAFESW 20 (101) Q Consensus 14 ~~afe~W 20 (101) +|+|.+| T Consensus 1 ~pafnsw 7 (8) T PF08260_consen 1 DPAFNSW 7 (8) T ss_pred Ccccccc Confidence 4667766 No 18 >PF10905 DUF2695: Protein of unknown function (DUF2695); InterPro: IPR024248 This bacterial family of proteins has no known function. Probab=27.46 E-value=39 Score=21.55 Aligned_cols=15 Identities=20% Similarity=0.450 Sum_probs=12.9 Q ss_pred ccCchHHHHhhhhcc Q 047994 11 NVPDPAFESWLRDSS 25 (101) Q Consensus 11 svp~~afe~WlrDsg 25 (101) +++++++..||+.+| T Consensus 29 ~~~~~~vl~~l~~nG 43 (53) T PF10905_consen 29 QLDWEDVLEWLRENG 43 (53) T ss_pred CCCHHHHHHHHHHcC Confidence 577899999999987 No 19 >PF12415 rpo132: Poxvirus DNA dependent RNA polymerase; InterPro: IPR024390 All three classes of poxvirus genes - early, intermediate and late - are transcribed by the viral RNA polymerase compex []. This complex is composed of nine distinct subunits which total more than 500kDa in mass. The two largest subunits (147 and 136kDa) are homologous to the largest subunits of eukaryotic and prokaryotic RNA polymerases and, like them, are thought to form a claw-shaped structure whose cleft is the site of template interaction and phosphodiester bond formation. While the smaller subunits of poxvirus RNA polymerase show much less similarity, if any, to the smaller subunits of the eukaryotic and prokaryotic enzymes, it is thought that they may play a similar role in interacting with transcription factors. The 132kDa subunit is the second largest subunit of the poxvirus DNA dependent RNA polymerase and shows structural similarity to the second-largest RNA polymerase subunits of eubacteria, archaebacteria, and eukaryotes. Probab=26.31 E-value=42 Score=19.82 Aligned_cols=33 Identities=30% Similarity=0.328 Sum_probs=25.0 Q ss_pred hhhcccccccCCCChhhhhhhhhhhHHHHhhhh Q 047994 58 EFIGALRSYSFPSSPHTLKLRVHENVKRYARNY 90 (101) Q Consensus 58 eF~g~~~SYSfP~s~~qarlRv~eNvkrY~rNY 90 (101) +|+-..=||.+|....-.--=+=||-|+...|+ T Consensus 1 dfI~~~Lsydmp~ei~ylvnalIestk~i~~~~ 33 (33) T PF12415_consen 1 DFIRNSLSYDMPPEIIYLVNALIESTKRILANN 33 (33) T ss_pred CHHHHhhccCCCHHHHHHHHHHHHHHHHHHhcC Confidence 456666789999988877777778888877664 No 20 >PLN02999 photosystem II oxygen-evolving enhancer 3 protein (PsbQ) Probab=26.13 E-value=75 Score=25.25 Aligned_cols=38 Identities=29% Similarity=0.405 Sum_probs=30.4 Q ss_pred chhhhcccccccCCCChhhhhhhhhhhHH--------------HHhhhhHHhH Q 047994 56 TREFIGALRSYSFPSSPHTLKLRVHENVK--------------RYARNYASLF 94 (101) Q Consensus 56 treF~g~~~SYSfP~s~~qarlRv~eNvk--------------rY~rNYa~l~ 94 (101) ||.|+ --+=|-=|-++.+|-.|+-|.++ +|+.||+.+- T Consensus 71 tRsfL-Kerfy~p~lspeeAaaRiK~sA~dLl~vK~LId~~aW~YVq~~LRlk 122 (190) T PLN02999 71 TRSFI-KEKYFMPGLSPEDAAARIKQTAEGLRDMREMLDHMSWRYVIFYIRLK 122 (190) T ss_pred hHHHH-HHhccCCCCCHHHHHHHHHHHHHHHHHHHHHhccccHHHHHHHHHHH Confidence 67787 45667789999999999988765 6888888764 No 21 >PRK10699 phosphatidylglycerophosphatase B; Provisional Probab=22.60 E-value=40 Score=26.91 Aligned_cols=25 Identities=24% Similarity=0.574 Sum_probs=19.1 Q ss_pred CCCCcchhhhcccccccCCCChhhh Q 047994 51 TTPSWTREFIGALRSYSFPSSPHTL 75 (101) Q Consensus 51 ~t~~WtreF~g~~~SYSfP~s~~qa 75 (101) +.++|-++---...+|||||+-++. T Consensus 142 ~~~~w~~~hw~~~~gySFPSGHa~~ 166 (244) T PRK10699 142 NIPQWLRSHWQKETGFAFPSGHTMF 166 (244) T ss_pred cCCHHHHhccCCCCCCCCChHHHHH Confidence 5677866665566899999998874 No 22 >KOG3471 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB2 [Transcription; Replication, recombination and repair] Probab=22.37 E-value=41 Score=29.86 Aligned_cols=28 Identities=25% Similarity=0.520 Sum_probs=22.2 Q ss_pred CCccCCCcccccCchHHHHhhhhcchhhHhhh Q 047994 1 MVFASNPLSLNVPDPAFESWLRDSSYLEILDT 32 (101) Q Consensus 1 M~F~~NPLSLsvp~~afe~WlrDsg~le~~d~ 32 (101) |.|+++| ||..+++.|++-+|-.|+-+. T Consensus 57 MLf~~~p----VP~a~~~~Wv~~~~tk~q~ea 84 (465) T KOG3471|consen 57 MLFKDQP----VPLADVDLWVKVEETKEQEEA 84 (465) T ss_pred HHhcCCC----ccHHHHHHHhhhhhHHHHHHH Confidence 5677776 688899999999987776655 No 23 >PF01277 Oleosin: Oleosin; InterPro: IPR000136 Oleosins [] are the proteinaceous components of plants' lipid storage bodies called oil bodies. Oil bodies are small droplets (0.2 to 1.5 mu-m in diameter) containing mostly triacylglycerol that are surrounded by a phospholipid/ oleosin annulus. Oleosins may have a structural role in stabilising the lipid body during dessication of the seed, by preventing coalescence of the oil. They may also provide recognition signals for specific lipase anchorage in lipolysis during seedling growth. Oleosins are found in the monolayer lipid/ water interface of oil bodies and probably interact with both the lipid and phospholipid moieties. Oleosins are proteins of 16 Kd to 24 Kd and are composed of three domains: an N-terminal hydrophilic region of variable length (from 30 to 60 residues); a central hydrophobic domain of about 70 residues and a C-terminal amphipathic region of variable length (from 60 to 100 residues). The central hydrophobic domain is proposed to be made up of beta-strand structure and to interact with the lipids []. It is the only domain whose sequence is conserved.; GO: 0012511 monolayer-surrounded lipid storage body, 0016021 integral to membrane Probab=21.80 E-value=83 Score=23.00 Aligned_cols=24 Identities=21% Similarity=0.202 Sum_probs=17.6 Q ss_pred cCCCChhhhhhhhhh---hHHHHhhhh Q 047994 67 SFPSSPHTLKLRVHE---NVKRYARNY 90 (101) Q Consensus 67 SfP~s~~qarlRv~e---NvkrY~rNY 90 (101) .-|...++||.|++| .++++++-| T Consensus 88 ~~~~q~d~Ak~ri~d~a~~v~~kake~ 114 (118) T PF01277_consen 88 PGPDQLDYAKRRIADTASYVGQKAKEV 114 (118) T ss_pred CCCccHHHHHHHHHHHHHHHHHHHHHh Confidence 347889999999985 566666544 Done!