Query         048001
Match_columns 48
No_of_seqs    14 out of 16
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 05:19:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048001.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048001hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0095 GTPase Rab30, small G   79.7     1.3 2.8E-05   31.3   1.8   39    4-43     63-105 (213)
  2 KOG0083 GTPase Rab26/Rab37, sm  70.7     2.8 6.1E-05   29.3   1.5   36    2-37     52-91  (192)
  3 COG0302 FolE GTP cyclohydrolas  62.9      13 0.00027   26.0   3.5   35   11-45    160-194 (195)
  4 KOG4147 Uncharacterized conser  62.7     5.6 0.00012   26.5   1.7   14   17-30      4-17  (127)
  5 PF02195 ParBc:  ParB-like nucl  51.6     8.5 0.00018   20.9   1.0   27    3-29     51-77  (90)
  6 PF02197 RIIa:  Regulatory subu  51.6     8.9 0.00019   19.7   1.0   16   30-45     18-35  (38)
  7 smart00470 ParB ParB-like nucl  39.1      15 0.00033   20.2   0.7   27    2-28     49-75  (89)
  8 COG2210 Peroxiredoxin family p  37.7      14 0.00031   24.3   0.6   24    5-32     77-100 (137)
  9 PF07503 zf-HYPF:  HypF finger;  31.5      21 0.00046   18.4   0.5    9   33-41      3-11  (35)
 10 cd00642 GTP_cyclohydro1 GTP cy  29.8   1E+02  0.0022   20.7   3.7   35   10-44    150-184 (185)
 11 PF15389 DUF4612:  Domain of un  24.2      47   0.001   21.4   1.2   11   33-43     88-98  (115)
 12 PRK09347 folE GTP cyclohydrola  22.3 1.7E+02  0.0038   19.6   3.7   34   10-43    153-186 (188)
 13 KOG0094 GTPase Rab6/YPT6/Ryh1,  22.0      45 0.00097   23.9   0.9   13    4-16     78-90  (221)
 14 KOG0080 GTPase Rab18, small G   20.6      36 0.00078   24.2   0.2   13    4-16     67-79  (209)
 15 KOG0084 GTPase Rab1/YPT1, smal  20.5      32  0.0007   24.2  -0.1   11    4-14     65-75  (205)
 16 COG5463 Predicted integral mem  20.2      52  0.0011   23.3   0.9   11   28-38     48-58  (198)
 17 PRK12606 GTP cyclohydrolase I;  20.1 1.9E+02   0.004   19.8   3.5   35   10-44    165-199 (201)

No 1  
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]
Probab=79.74  E-value=1.3  Score=31.33  Aligned_cols=39  Identities=21%  Similarity=0.348  Sum_probs=31.7

Q ss_pred             ehhhhhhheeeee----CeeeEEEEeeeeeeehHhHHHHHHHHh
Q 048001            4 AITLKRYRAVKEV----GKIKMSVGVIAYYQLVQVCQAEYFRQL   43 (48)
Q Consensus         4 a~~qtrfRalK~~----g~~~i~VrvIAcyQ~~q~CQaeyFr~l   43 (48)
                      .++|.|||++-..    ...-|.|==|.| ||.-+|--|+.|.+
T Consensus        63 tagqerfrsitqsyyrsahalilvydisc-qpsfdclpewlrei  105 (213)
T KOG0095|consen   63 TAGQERFRSITQSYYRSAHALILVYDISC-QPSFDCLPEWLREI  105 (213)
T ss_pred             ccchHHHHHHHHHHhhhcceEEEEEeccc-CcchhhhHHHHHHH
Confidence            4789999998765    455677777877 99999999999875


No 2  
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only]
Probab=70.73  E-value=2.8  Score=29.29  Aligned_cols=36  Identities=22%  Similarity=0.260  Sum_probs=30.2

Q ss_pred             eeehhhhhhheeeee----CeeeEEEEeeeeeeehHhHHH
Q 048001            2 YIAITLKRYRAVKEV----GKIKMSVGVIAYYQLVQVCQA   37 (48)
Q Consensus         2 ~~a~~qtrfRalK~~----g~~~i~VrvIAcyQ~~q~CQa   37 (48)
                      +-.++|.|||++-|.    ...-..+==||+=-+-++||+
T Consensus        52 wdtagqerfrsvt~ayyrda~allllydiankasfdn~~~   91 (192)
T KOG0083|consen   52 WDTAGQERFRSVTHAYYRDADALLLLYDIANKASFDNCQA   91 (192)
T ss_pred             eeccchHHHhhhhHhhhcccceeeeeeecccchhHHHHHH
Confidence            446899999999987    556677888999999999997


No 3  
>COG0302 FolE GTP cyclohydrolase I [Coenzyme metabolism]
Probab=62.93  E-value=13  Score=26.03  Aligned_cols=35  Identities=17%  Similarity=0.325  Sum_probs=32.0

Q ss_pred             heeeeeCeeeEEEEeeeeeeehHhHHHHHHHHhcc
Q 048001           11 RAVKEVGKIKMSVGVIAYYQLVQVCQAEYFRQLLK   45 (48)
Q Consensus        11 RalK~~g~~~i~VrvIAcyQ~~q~CQaeyFr~llk   45 (48)
                      |.+|..|+.|++.-+-.-|...+.+++|+++.+-+
T Consensus       160 RGv~k~~s~t~Ts~~~G~F~~~~~~R~efl~li~~  194 (195)
T COG0302         160 RGVRKPGSSTVTSALRGLFKEDAKTRAEFLRLIKG  194 (195)
T ss_pred             cCccCCCceEEEEeeeeeeccCHHHHHHHHHHHhc
Confidence            78899999999999999999999999999987653


No 4  
>KOG4147 consensus Uncharacterized conserved protein [Function unknown]
Probab=62.68  E-value=5.6  Score=26.45  Aligned_cols=14  Identities=29%  Similarity=0.693  Sum_probs=12.2

Q ss_pred             CeeeEEEEeeeeee
Q 048001           17 GKIKMSVGVIAYYQ   30 (48)
Q Consensus        17 g~~~i~VrvIAcyQ   30 (48)
                      |+.+|+||||-.|-
T Consensus         4 ~~~tiTvRvIrsFe   17 (127)
T KOG4147|consen    4 GEVTITVRVIRSFE   17 (127)
T ss_pred             CccEEEEEEEeccc
Confidence            67899999999874


No 5  
>PF02195 ParBc:  ParB-like nuclease domain;  InterPro: IPR003115 Proteins containing this domain, appear to be related to the Escherichia coli plasmid protein ParB, which preferentially cleaves single-stranded DNA. ParB also nicks supercoiled plasmid DNA preferably at sites with potential single-stranded character, like AT-rich regions and sequences that can form cruciform structures. ParB also exhibits 5--3 exonuclease activity.; GO: 0003677 DNA binding; PDB: 1VK1_A 3CYI_A 1YZS_A 2RII_X 2B6F_A 3HY2_Y 1XW4_X 1XW3_A 1VZ0_G 1R71_C ....
Probab=51.64  E-value=8.5  Score=20.89  Aligned_cols=27  Identities=30%  Similarity=0.286  Sum_probs=21.4

Q ss_pred             eehhhhhhheeeeeCeeeEEEEeeeee
Q 048001            3 IAITLKRYRAVKEVGKIKMSVGVIAYY   29 (48)
Q Consensus         3 ~a~~qtrfRalK~~g~~~i~VrvIAcy   29 (48)
                      +..+..|++|.++.|..+|-|.++..-
T Consensus        51 IidG~~R~~A~~~lg~~~i~v~v~~~~   77 (90)
T PF02195_consen   51 IIDGHHRLRAARELGLETIPVIVVDVD   77 (90)
T ss_dssp             EEE-HHHHHHHHHHT-SEEEEEEEECT
T ss_pred             CCCCHHHHHHHHHcCCCeEeEEEEECC
Confidence            567899999999999989999887654


No 6  
>PF02197 RIIa:  Regulatory subunit of type II PKA R-subunit;  InterPro: IPR003117 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases [].  In the absence of cAMP, Protein Kinase A (PKA) exists as an equimolar tetramer of regulatory (R) and catalytic (C) subunits []. In addition to its role as an inhibitor of the C subunit, the R subunit anchors the holoenzyme to specific intracellular locations and prevents the C subunit from entering the nucleus. All R subunits have a conserved domain structure consisting of the N-terminal dimerization domain, inhibitory region, cAMP-binding domain A and cAMP-binding domain B. R subunits interact with C subunits primarily through the inhibitory site. The cAMP-binding domains show extensive sequence similarity and bind cAMP cooperatively.  Two types of regulatory (R) subunits exist - types I and I - which differ in molecular weight, sequence, autophosphorylation cabaility, cellular location and tissue distribution. Types I and II were further sub-divided into alpha and beta subtypes, based mainly on sequence similarity. This entry represents types I-alpha, I-beta, II-alpha and II-beta regulatory subunits of PKA proteins. These subunits contain the dimerisation interface and binding site for A-kinase-anchoring proteins (AKAPs).; GO: 0008603 cAMP-dependent protein kinase regulator activity, 0007165 signal transduction; PDB: 2IZY_E 1R2A_A 1L6E_A 2IZX_B 2KYG_A 2EZW_B 3IM4_B 3IM3_A 4F9K_C 2HWN_B ....
Probab=51.55  E-value=8.9  Score=19.72  Aligned_cols=16  Identities=44%  Similarity=0.602  Sum_probs=9.5

Q ss_pred             eehHhHH--HHHHHHhcc
Q 048001           30 QLVQVCQ--AEYFRQLLK   45 (48)
Q Consensus        30 Q~~q~CQ--aeyFr~llk   45 (48)
                      ||.+..|  ++||..|++
T Consensus        18 qP~Di~~F~a~yF~~L~~   35 (38)
T PF02197_consen   18 QPDDILQFAADYFEKLEK   35 (38)
T ss_dssp             --S-HHHHHHHHHHHHHH
T ss_pred             CCCcHHHHHHHHHHHHHH
Confidence            5666655  689988865


No 7  
>smart00470 ParB ParB-like nuclease domain. Plasmid RK2 ParB preferentially cleaves single-stranded DNA. ParB also nicks supercoiled plasmid DNA preferably at sites with potential single-stranded character, like AT-rich regions and sequences that can form cruciform structures. ParB also exhibits 5--3 exonuclease activity.
Probab=39.10  E-value=15  Score=20.21  Aligned_cols=27  Identities=30%  Similarity=0.185  Sum_probs=22.5

Q ss_pred             eeehhhhhhheeeeeCeeeEEEEeeee
Q 048001            2 YIAITLKRYRAVKEVGKIKMSVGVIAY   28 (48)
Q Consensus         2 ~~a~~qtrfRalK~~g~~~i~VrvIAc   28 (48)
                      .+..+..|++|.+..|..+|-+.++..
T Consensus        49 ~vidG~~R~~A~~~lg~~~ip~~v~~~   75 (89)
T smart00470       49 EIIDGERRLRAAKLLGLKEVPVIVRDL   75 (89)
T ss_pred             EEEeCHHHHHHHHHcCCCceeEEEEcC
Confidence            456788999999999988888888763


No 8  
>COG2210 Peroxiredoxin family protein [General function prediction only]
Probab=37.68  E-value=14  Score=24.29  Aligned_cols=24  Identities=29%  Similarity=0.207  Sum_probs=17.6

Q ss_pred             hhhhhhheeeeeCeeeEEEEeeeeeeeh
Q 048001            5 ITLKRYRAVKEVGKIKMSVGVIAYYQLV   32 (48)
Q Consensus         5 ~~qtrfRalK~~g~~~i~VrvIAcyQ~~   32 (48)
                      .+...+|..|++|.    |+||||==.|
T Consensus        77 ~~le~l~~ak~~~~----vkv~AC~mtm  100 (137)
T COG2210          77 AWLELLREAKKDGG----VKVYACSMTM  100 (137)
T ss_pred             cHHHHHHHHhhhcC----cEEEEehhHH
Confidence            45667888898877    8889984433


No 9  
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=31.45  E-value=21  Score=18.40  Aligned_cols=9  Identities=44%  Similarity=0.947  Sum_probs=7.3

Q ss_pred             HhHHHHHHH
Q 048001           33 QVCQAEYFR   41 (48)
Q Consensus        33 q~CQaeyFr   41 (48)
                      ++|+.||+.
T Consensus         3 ~~C~~Ey~~   11 (35)
T PF07503_consen    3 DDCLKEYFD   11 (35)
T ss_dssp             HHHHHHHCS
T ss_pred             HHHHHHHcC
Confidence            589999973


No 10 
>cd00642 GTP_cyclohydro1 GTP cyclohydrolase I (GTP-CH-I) catalyzes the conversion of GTP into dihydroneopterin triphosphate.  The enzyme product is the precursor of tetrahydrofolate in eubacteria, fungi, and plants and of the folate analogs in methanogenic bacteria.  In vertebrates and insects it is the biosynthtic precursor of tetrahydrobiopterin (BH4) which is involved in the formation of catacholamines, nitric oxide, and the stimulation of T lymphocytes. The biosynthetic reaction of BH4 is controlled by a regulatory protein GFRP which mediates feedback inhibition of GTP-CH-I by BH4.  This inhibition is reversed by phenylalanine. The decameric GTP-CH-I forms a complex with two pentameric GFRP in the presence of phenylalanine or a combination of GTP and BH4, respectively.
Probab=29.76  E-value=1e+02  Score=20.68  Aligned_cols=35  Identities=14%  Similarity=0.344  Sum_probs=30.2

Q ss_pred             hheeeeeCeeeEEEEeeeeeeehHhHHHHHHHHhc
Q 048001           10 YRAVKEVGKIKMSVGVIAYYQLVQVCQAEYFRQLL   44 (48)
Q Consensus        10 fRalK~~g~~~i~VrvIAcyQ~~q~CQaeyFr~ll   44 (48)
                      -|.+|..|..|.+.-.--+|+.-..-..|+|+.+-
T Consensus       150 ~RGv~~~~s~t~T~a~~G~F~~~~~~r~ef~~~~~  184 (185)
T cd00642         150 MRGVRKPGSKTVTSAMLGVFKEDPKTREEFLRLIR  184 (185)
T ss_pred             hcCcccCCCeEEEEEeEEEECCCHHHHHHHHHHhc
Confidence            37788889999999999999998888999998764


No 11 
>PF15389 DUF4612:  Domain of unknown function (DUF4612)
Probab=24.25  E-value=47  Score=21.43  Aligned_cols=11  Identities=36%  Similarity=0.709  Sum_probs=9.0

Q ss_pred             HhHHHHHHHHh
Q 048001           33 QVCQAEYFRQL   43 (48)
Q Consensus        33 q~CQaeyFr~l   43 (48)
                      -.=|++|||-|
T Consensus        88 S~SQqdFFRML   98 (115)
T PF15389_consen   88 SESQQDFFRML   98 (115)
T ss_pred             hHHHHHHHHHH
Confidence            46799999976


No 12 
>PRK09347 folE GTP cyclohydrolase I; Provisional
Probab=22.30  E-value=1.7e+02  Score=19.63  Aligned_cols=34  Identities=15%  Similarity=0.345  Sum_probs=29.9

Q ss_pred             hheeeeeCeeeEEEEeeeeeeehHhHHHHHHHHh
Q 048001           10 YRAVKEVGKIKMSVGVIAYYQLVQVCQAEYFRQL   43 (48)
Q Consensus        10 fRalK~~g~~~i~VrvIAcyQ~~q~CQaeyFr~l   43 (48)
                      -|.+|..|..|++.-.--+|+.-..-..|+|+.+
T Consensus       153 ~RGv~~~~s~t~T~~~~G~F~~~~~~r~ef~~~i  186 (188)
T PRK09347        153 MRGVRKPGSKTVTSALRGLFKTDPATRAEFLSLI  186 (188)
T ss_pred             hhCceeCCceEEEEEEEeEeCCCHHHHHHHHHHh
Confidence            4778888999999899999999899999999876


No 13 
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]
Probab=22.02  E-value=45  Score=23.89  Aligned_cols=13  Identities=15%  Similarity=0.312  Sum_probs=11.0

Q ss_pred             ehhhhhhheeeee
Q 048001            4 AITLKRYRAVKEV   16 (48)
Q Consensus         4 a~~qtrfRalK~~   16 (48)
                      -|+|.|||.|-.-
T Consensus        78 TAGQERFrslips   90 (221)
T KOG0094|consen   78 TAGQERFRSLIPS   90 (221)
T ss_pred             cccHHHHhhhhhh
Confidence            5899999999765


No 14 
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only]
Probab=20.59  E-value=36  Score=24.25  Aligned_cols=13  Identities=15%  Similarity=0.355  Sum_probs=10.9

Q ss_pred             ehhhhhhheeeee
Q 048001            4 AITLKRYRAVKEV   16 (48)
Q Consensus         4 a~~qtrfRalK~~   16 (48)
                      -|+|.|||+|-..
T Consensus        67 TAGqErFRtLTpS   79 (209)
T KOG0080|consen   67 TAGQERFRTLTPS   79 (209)
T ss_pred             ccchHhhhccCHh
Confidence            4789999999765


No 15 
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=20.53  E-value=32  Score=24.17  Aligned_cols=11  Identities=18%  Similarity=0.504  Sum_probs=8.6

Q ss_pred             ehhhhhhheee
Q 048001            4 AITLKRYRAVK   14 (48)
Q Consensus         4 a~~qtrfRalK   14 (48)
                      -|+|.|||++=
T Consensus        65 TAGQERFrtit   75 (205)
T KOG0084|consen   65 TAGQERFRTIT   75 (205)
T ss_pred             ccccHHHhhhh
Confidence            47899999764


No 16 
>COG5463 Predicted integral membrane protein [Function unknown]
Probab=20.20  E-value=52  Score=23.26  Aligned_cols=11  Identities=45%  Similarity=0.661  Sum_probs=9.1

Q ss_pred             eeeehHhHHHH
Q 048001           28 YYQLVQVCQAE   38 (48)
Q Consensus        28 cyQ~~q~CQae   38 (48)
                      -||.+++|++.
T Consensus        48 lY~svddC~aa   58 (198)
T COG5463          48 LYQSVDDCIAA   58 (198)
T ss_pred             eeccHHHHHHc
Confidence            59999999873


No 17 
>PRK12606 GTP cyclohydrolase I; Reviewed
Probab=20.14  E-value=1.9e+02  Score=19.84  Aligned_cols=35  Identities=11%  Similarity=0.218  Sum_probs=30.2

Q ss_pred             hheeeeeCeeeEEEEeeeeeeehHhHHHHHHHHhc
Q 048001           10 YRAVKEVGKIKMSVGVIAYYQLVQVCQAEYFRQLL   44 (48)
Q Consensus        10 fRalK~~g~~~i~VrvIAcyQ~~q~CQaeyFr~ll   44 (48)
                      -|.+|..|..|.+.-+--.|+....-..|+|+.+-
T Consensus       165 ~RGv~~~~s~t~T~a~~G~F~~d~~~r~efl~~~~  199 (201)
T PRK12606        165 MRGVRKQNSRMITSVMLGAFRDSAQTRNEFLRLIG  199 (201)
T ss_pred             hcCccCCCCeEEEEEeeeEeCCCHHHHHHHHHHhc
Confidence            37788889999999999999999899999998763


Done!