Query         048032
Match_columns 93
No_of_seqs    170 out of 1114
Neff          10.1
Searched_HMMs 46136
Date          Fri Mar 29 05:37:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048032.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048032hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1187 Serine/threonine prote  99.1 1.9E-10 4.2E-15   75.0   3.9   41   53-93     61-103 (361)
  2 KOG1025 Epidermal growth facto  97.6 4.6E-05   1E-09   54.7   2.3   20   72-91    703-723 (1177)
  3 PLN00113 leucine-rich repeat r  97.6 0.00011 2.4E-09   53.3   4.1   37   56-93    682-719 (968)
  4 KOG3653 Transforming growth fa  97.6 1.6E-05 3.4E-10   53.6  -0.2   23   70-93    215-237 (534)
  5 KOG0196 Tyrosine kinase, EPH (  97.0 0.00099 2.1E-08   47.9   3.8   34   54-87    607-651 (996)
  6 KOG2052 Activin A type IB rece  96.6  0.0057 1.2E-07   41.5   4.9   19   71-89    217-235 (513)
  7 cd06624 STKc_ASK Catalytic dom  96.0  0.0033 7.1E-08   38.9   1.3   27   62-88      3-31  (268)
  8 PLN03224 probable serine/threo  95.9  0.0054 1.2E-07   42.3   2.0   21   66-86    144-166 (507)
  9 PF03109 ABC1:  ABC1 family;  I  95.6   0.006 1.3E-07   34.1   1.0   26   68-93     13-39  (119)
 10 KOG0658 Glycogen synthase kina  95.5  0.0091   2E-07   39.3   1.8   22   72-93     31-53  (364)
 11 KOG0193 Serine/threonine prote  95.4    0.01 2.2E-07   41.7   1.9   17   71-87    398-414 (678)
 12 TIGR01982 UbiB 2-polyprenylphe  95.4   0.012 2.6E-07   39.8   2.2   22   72-93    124-145 (437)
 13 KOG0591 NIMA (never in mitosis  95.2  0.0094   2E-07   38.6   1.1   22   72-93     26-48  (375)
 14 KOG0595 Serine/threonine-prote  95.2   0.016 3.4E-07   38.9   2.2   22   72-93     17-39  (429)
 15 PLN03225 Serine/threonine-prot  95.1   0.016 3.4E-07   40.5   2.1   23   66-88    131-155 (566)
 16 cd05067 PTKc_Lck_Blk Catalytic  95.1   0.013 2.9E-07   36.0   1.7   24   70-93     11-34  (260)
 17 cd05144 RIO2_C RIO kinase fami  94.6   0.027 5.9E-07   33.7   2.1   23   71-93     21-43  (198)
 18 PHA02882 putative serine/threo  94.5   0.027 5.9E-07   35.6   2.0   18   72-89     19-36  (294)
 19 KOG0600 Cdc2-related protein k  94.4   0.019 4.1E-07   39.6   1.1   22   72-93    124-146 (560)
 20 cd07879 STKc_p38delta_MAPK13 C  94.3   0.046   1E-06   35.3   2.6   21   72-92     22-43  (342)
 21 smart00090 RIO RIO-like kinase  94.2   0.038 8.1E-07   34.4   2.1   23   71-93     34-58  (237)
 22 KOG0594 Protein kinase PCTAIRE  94.1   0.038 8.3E-07   36.1   2.0   22   72-93     18-40  (323)
 23 cd06639 STKc_myosinIIIB Cataly  94.1   0.018 3.9E-07   36.1   0.4   36   57-92     12-50  (291)
 24 cd06638 STKc_myosinIIIA Cataly  94.0   0.028 6.1E-07   35.1   1.2   35   57-91      8-45  (286)
 25 cd05064 PTKc_EphR_A10 Catalyti  93.7   0.049 1.1E-06   33.8   1.9   17   70-86     10-26  (266)
 26 PRK09188 serine/threonine prot  93.6   0.055 1.2E-06   36.0   2.1   21   72-92     25-47  (365)
 27 PF14575 EphA2_TM:  Ephrin type  93.6   0.042 9.1E-07   28.4   1.2   20   54-73     54-73  (75)
 28 cd05072 PTKc_Lyn Catalytic dom  93.6    0.06 1.3E-06   33.1   2.2   22   71-92     12-33  (261)
 29 cd06637 STKc_TNIK Catalytic do  93.6   0.035 7.5E-07   34.3   1.1   21   72-92     13-34  (272)
 30 PTZ00284 protein kinase; Provi  93.6    0.03 6.5E-07   37.9   0.8   29   65-93    127-158 (467)
 31 cd07877 STKc_p38alpha_MAPK14 C  93.5   0.084 1.8E-06   34.2   2.7   35   59-93      9-46  (345)
 32 KOG1035 eIF-2alpha kinase GCN2  93.3   0.047   1E-06   41.3   1.5   26   66-91    478-506 (1351)
 33 cd05068 PTKc_Frk_like Catalyti  93.3   0.049 1.1E-06   33.5   1.4   22   71-92     12-33  (261)
 34 cd05070 PTKc_Fyn_Yrk Catalytic  93.3   0.072 1.6E-06   32.8   2.1   22   71-92     12-33  (260)
 35 cd05103 PTKc_VEGFR2 Catalytic   93.1   0.062 1.3E-06   34.8   1.8   16   70-85     12-27  (343)
 36 cd05034 PTKc_Src_like Catalyti  92.9   0.088 1.9E-06   32.3   2.1   22   71-92     12-33  (261)
 37 cd05114 PTKc_Tec_Rlk Catalytic  92.8   0.082 1.8E-06   32.5   1.9   21   71-91     10-30  (256)
 38 cd06636 STKc_MAP4K4_6 Catalyti  92.8   0.088 1.9E-06   32.8   2.0   35   58-92      7-44  (282)
 39 cd05112 PTKc_Itk Catalytic dom  92.7   0.082 1.8E-06   32.4   1.8   22   70-91      9-30  (256)
 40 PRK04750 ubiB putative ubiquin  92.5    0.14 3.1E-06   35.8   2.9   22   72-93    126-148 (537)
 41 cd05096 PTKc_DDR1 Catalytic do  92.5   0.098 2.1E-06   33.1   1.9   18   71-88     11-28  (304)
 42 KOG0663 Protein kinase PITSLRE  92.4   0.069 1.5E-06   35.4   1.2   22   72-93     83-105 (419)
 43 KOG4250 TANK binding protein k  92.4   0.073 1.6E-06   38.1   1.4   23   71-93     19-42  (732)
 44 cd05043 PTK_Ryk Pseudokinase d  92.4   0.097 2.1E-06   32.6   1.8   18   71-88     12-29  (280)
 45 PTZ00036 glycogen synthase kin  92.3    0.11 2.4E-06   35.1   2.1   22   72-93     73-95  (440)
 46 cd05108 PTKc_EGFR Catalytic do  92.3   0.099 2.1E-06   33.3   1.8   16   72-87     14-29  (316)
 47 cd05102 PTKc_VEGFR3 Catalytic   92.2   0.088 1.9E-06   33.8   1.5   16   71-86     13-28  (338)
 48 PTZ00283 serine/threonine prot  92.2    0.11 2.3E-06   35.8   2.0   22   72-93     39-61  (496)
 49 cd06616 PKc_MKK4 Catalytic dom  92.2    0.21 4.6E-06   31.2   3.2   21   72-92     11-32  (288)
 50 KOG0192 Tyrosine kinase specif  92.2    0.12 2.6E-06   34.3   2.1   19   72-90     48-66  (362)
 51 cd05073 PTKc_Hck Catalytic dom  92.1     0.1 2.3E-06   32.1   1.7   21   71-91     12-32  (260)
 52 cd05033 PTKc_EphR Catalytic do  92.0    0.12 2.6E-06   31.9   1.9   18   70-87      9-26  (266)
 53 cd05071 PTKc_Src Catalytic dom  92.0    0.12 2.6E-06   32.0   1.9   22   71-92     12-33  (262)
 54 KOG0201 Serine/threonine prote  91.9    0.11 2.4E-06   35.4   1.7   16   71-86     19-34  (467)
 55 cd05104 PTKc_Kit Catalytic dom  91.8    0.13 2.9E-06   33.8   2.0   16   71-86     41-56  (375)
 56 KOG4236 Serine/threonine prote  91.6    0.16 3.4E-06   36.0   2.2   26   68-93    566-593 (888)
 57 cd05148 PTKc_Srm_Brk Catalytic  91.5    0.13 2.8E-06   31.6   1.7   22   71-92     12-33  (261)
 58 KOG1166 Mitotic checkpoint ser  91.3    0.15 3.2E-06   38.0   2.0   22   72-93    705-726 (974)
 59 PLN00034 mitogen-activated pro  91.1     0.2 4.3E-06   32.6   2.3   21   72-92     81-102 (353)
 60 KOG0605 NDR and related serine  91.1    0.21 4.4E-06   34.8   2.4   22   72-93    148-170 (550)
 61 cd07878 STKc_p38beta_MAPK11 Ca  91.0    0.36 7.7E-06   31.2   3.3   21   72-92     22-43  (343)
 62 KOG0194 Protein tyrosine kinas  90.8    0.15 3.3E-06   35.1   1.6   17   71-87    163-179 (474)
 63 KOG0581 Mitogen-activated prot  90.7    0.37   8E-06   32.1   3.2   21   72-92     86-107 (364)
 64 PTZ00263 protein kinase A cata  90.7    0.19 4.1E-06   32.4   1.9   22   71-92     24-46  (329)
 65 cd07871 STKc_PCTAIRE3 Catalyti  90.5    0.24 5.3E-06   31.1   2.2   22   71-92     11-33  (288)
 66 cd05090 PTKc_Ror1 Catalytic do  90.4    0.21 4.6E-06   31.1   1.9   17   70-86     10-26  (283)
 67 cd05113 PTKc_Btk_Bmx Catalytic  90.3     0.2 4.3E-06   30.9   1.7   21   70-90      9-29  (256)
 68 cd05069 PTKc_Yes Catalytic dom  90.2    0.25 5.4E-06   30.4   2.1   22   70-91     11-32  (260)
 69 PHA02988 hypothetical protein;  90.2    0.22 4.8E-06   31.4   1.9   35   54-92     12-46  (283)
 70 cd06646 STKc_MAP4K5 Catalytic   90.0     0.3 6.6E-06   30.1   2.4   21   72-92     16-37  (267)
 71 cd05054 PTKc_VEGFR Catalytic d  90.0     0.2 4.2E-06   32.5   1.5   16   71-86     13-28  (337)
 72 cd05059 PTKc_Tec_like Catalyti  90.0    0.23 5.1E-06   30.5   1.8   20   70-89      9-28  (256)
 73 COG0661 AarF Predicted unusual  89.9    0.18 3.8E-06   35.2   1.3   26   68-93    127-153 (517)
 74 cd05109 PTKc_HER2 Catalytic do  89.8    0.28 6.1E-06   30.5   2.1   20   71-90     13-33  (279)
 75 cd05622 STKc_ROCK1 Catalytic d  89.8     0.2 4.4E-06   33.0   1.5   16   72-87     50-65  (371)
 76 cd06641 STKc_MST3 Catalytic do  89.7     0.3 6.4E-06   30.4   2.1   23   70-92      9-32  (277)
 77 cd07864 STKc_CDK12 Catalytic d  89.6    0.38 8.2E-06   30.2   2.6   21   72-92     14-35  (302)
 78 cd05111 PTK_HER3 Pseudokinase   89.6    0.28 6.1E-06   30.6   2.0   16   71-86     13-28  (279)
 79 cd05039 PTKc_Csk_like Catalyti  89.5    0.28   6E-06   30.1   1.9   19   70-88     11-29  (256)
 80 cd07872 STKc_PCTAIRE2 Catalyti  89.3    0.34 7.4E-06   30.7   2.2   16   72-87     13-28  (309)
 81 cd05063 PTKc_EphR_A2 Catalytic  89.2    0.28   6E-06   30.3   1.7   17   71-87     11-27  (268)
 82 cd05621 STKc_ROCK2 Catalytic d  89.2    0.22 4.9E-06   32.8   1.3   21   72-92     50-71  (370)
 83 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  89.0    0.37 8.1E-06   30.0   2.2   17   70-86      9-25  (284)
 84 KOG0577 Serine/threonine prote  89.0    0.29 6.4E-06   35.1   1.8   22   72-93     33-55  (948)
 85 PRK09605 bifunctional UGMP fam  88.9    0.34 7.4E-06   33.6   2.1   20   71-90    339-358 (535)
 86 cd05088 PTKc_Tie2 Catalytic do  88.8    0.31 6.8E-06   30.9   1.8   18   70-87     12-29  (303)
 87 cd07869 STKc_PFTAIRE1 Catalyti  88.6    0.37 8.1E-06   30.5   2.0   22   71-92     11-33  (303)
 88 cd05105 PTKc_PDGFR_alpha Catal  88.6     0.3 6.6E-06   32.6   1.7   16   71-86     43-58  (400)
 89 cd06620 PKc_MAPKK_Byr1_like Ca  88.5    0.45 9.7E-06   29.7   2.3   22   71-92     11-33  (284)
 90 cd05596 STKc_ROCK Catalytic do  88.5    0.18 3.9E-06   33.2   0.5   21   72-92     50-71  (370)
 91 KOG0575 Polo-like serine/threo  88.4    0.42 9.1E-06   33.7   2.3   22   72-93     25-47  (592)
 92 cd07870 STKc_PFTAIRE2 Catalyti  88.4    0.33 7.2E-06   30.4   1.7   20   72-91     12-32  (291)
 93 cd07856 STKc_Sty1_Hog1 Catalyt  88.3    0.24 5.2E-06   31.9   1.1   31   62-92      5-38  (328)
 94 cd05091 PTKc_Ror2 Catalytic do  88.2    0.42 9.2E-06   29.7   2.1   17   71-87     11-27  (283)
 95 cd05106 PTKc_CSF-1R Catalytic   88.1    0.37   8E-06   31.8   1.8   16   71-86     44-59  (374)
 96 cd06649 PKc_MEK2 Catalytic dom  88.1     0.5 1.1E-05   30.4   2.4   21   72-92     12-33  (331)
 97 KOG1095 Protein tyrosine kinas  87.9    0.31 6.8E-06   36.6   1.5   17   71-87    698-714 (1025)
 98 KOG0661 MAPK related serine/th  87.8    0.46   1E-05   32.9   2.1   22   72-93     17-39  (538)
 99 cd07845 STKc_CDK10 Catalytic d  87.7    0.49 1.1E-05   30.0   2.2   21   72-92     14-35  (309)
100 cd06657 STKc_PAK4 Catalytic do  87.6    0.59 1.3E-05   29.6   2.5   21   72-92     27-48  (292)
101 cd06618 PKc_MKK7 Catalytic dom  87.6    0.53 1.2E-05   29.6   2.3   22   71-92     21-43  (296)
102 cd06642 STKc_STK25-YSK1 Cataly  87.5    0.58 1.3E-05   29.1   2.4   22   71-92     10-32  (277)
103 cd05049 PTKc_Trk Catalytic dom  87.4     0.4 8.6E-06   29.7   1.6   18   71-88     11-28  (280)
104 cd07876 STKc_JNK2 Catalytic do  87.2    0.59 1.3E-05   30.4   2.3   21   72-92     28-49  (359)
105 cd07873 STKc_PCTAIRE1 Catalyti  87.0    0.59 1.3E-05   29.5   2.3   21   72-92     13-34  (301)
106 cd05065 PTKc_EphR_B Catalytic   87.0    0.47   1E-05   29.3   1.8   18   70-87      9-26  (269)
107 PTZ00024 cyclin-dependent prot  86.9    0.61 1.3E-05   29.9   2.3   21   72-92     16-37  (335)
108 cd07844 STKc_PCTAIRE_like Cata  86.7     0.6 1.3E-05   29.2   2.1   22   71-92     11-33  (291)
109 cd06650 PKc_MEK1 Catalytic dom  86.7    0.71 1.5E-05   29.8   2.5   20   72-91     12-32  (333)
110 cd07880 STKc_p38gamma_MAPK12 C  86.5    0.63 1.4E-05   30.1   2.2   21   72-92     22-43  (343)
111 PHA03209 serine/threonine kina  86.5    0.67 1.5E-05   30.3   2.3   17   72-88     73-89  (357)
112 cd05057 PTKc_EGFR_like Catalyt  86.5    0.52 1.1E-05   29.3   1.8   17   71-87     13-29  (279)
113 cd05107 PTKc_PDGFR_beta Cataly  86.4    0.58 1.3E-05   31.4   2.1   17   71-87     43-59  (401)
114 KOG0198 MEKK and related serin  86.3    0.67 1.5E-05   30.4   2.2   20   71-90     23-43  (313)
115 cd06645 STKc_MAP4K3 Catalytic   86.2    0.69 1.5E-05   28.5   2.2   22   71-92     15-37  (267)
116 PF15102 TMEM154:  TMEM154 prot  86.0    0.92   2E-05   26.4   2.4    6   57-62    125-130 (146)
117 cd07849 STKc_ERK1_2_like Catal  86.0    0.58 1.3E-05   30.1   1.9   21   72-92     12-33  (336)
118 KOG0032 Ca2+/calmodulin-depend  85.9    0.69 1.5E-05   31.1   2.2   23   71-93     41-64  (382)
119 cd06644 STKc_STK10_LOK Catalyt  85.9    0.81 1.8E-05   28.7   2.4   20   72-91     19-39  (292)
120 cd05038 PTKc_Jak_rpt2 Catalyti  85.9    0.66 1.4E-05   28.7   2.0   17   71-87     10-26  (284)
121 cd07851 STKc_p38 Catalytic dom  85.9    0.59 1.3E-05   30.2   1.9   21   72-92     22-43  (343)
122 KOG1164 Casein kinase (serine/  85.6    0.57 1.2E-05   30.3   1.7   16   72-87     25-40  (322)
123 cd07852 STKc_MAPK15 Catalytic   85.6    0.81 1.8E-05   29.4   2.4   22   71-92     13-35  (337)
124 KOG1163 Casein kinase (serine/  85.5    0.55 1.2E-05   30.2   1.5   22   72-93     22-44  (341)
125 PHA03210 serine/threonine kina  85.4    0.59 1.3E-05   32.2   1.7   15   72-86    155-169 (501)
126 PTZ00426 cAMP-dependent protei  85.3    0.64 1.4E-05   30.2   1.8   17   71-87     36-52  (340)
127 cd05048 PTKc_Ror Catalytic Dom  85.3    0.68 1.5E-05   28.8   1.9   17   71-87     11-27  (283)
128 cd06656 STKc_PAK3 Catalytic do  85.1    0.78 1.7E-05   29.0   2.1   21   72-92     26-47  (297)
129 cd06607 STKc_TAO Catalytic dom  85.1     0.9   2E-05   28.8   2.4   21   72-92     22-43  (307)
130 cd05082 PTKc_Csk Catalytic dom  84.9    0.88 1.9E-05   27.9   2.2   18   71-88     12-29  (256)
131 cd05052 PTKc_Abl Catalytic dom  84.9    0.77 1.7E-05   28.3   2.0   17   71-87     12-28  (263)
132 cd05110 PTKc_HER4 Catalytic do  84.9     0.7 1.5E-05   29.3   1.8   15   72-86     14-28  (303)
133 cd05036 PTKc_ALK_LTK Catalytic  84.8    0.61 1.3E-05   29.0   1.5   17   72-88     13-29  (277)
134 cd07854 STKc_MAPK4_6 Catalytic  84.6    0.96 2.1E-05   29.3   2.4   22   71-92     11-33  (342)
135 cd07843 STKc_CDC2L1 Catalytic   84.5    0.91   2E-05   28.4   2.2   21   72-92     12-33  (293)
136 KOG0580 Serine/threonine prote  84.4     0.8 1.7E-05   29.2   1.8   17   72-88     29-45  (281)
137 KOG1006 Mitogen-activated prot  84.4    0.43 9.3E-06   31.0   0.7   20   72-91     71-91  (361)
138 cd05046 PTK_CCK4 Pseudokinase   84.3     0.8 1.7E-05   28.3   1.9   16   72-87     12-27  (275)
139 KOG1026 Nerve growth factor re  84.3    0.43 9.4E-06   34.8   0.7   20   69-88    490-509 (774)
140 PHA03212 serine/threonine kina  84.2    0.99 2.1E-05   30.1   2.3   21   72-92     99-120 (391)
141 KOG0574 STE20-like serine/thre  84.1    0.12 2.6E-06   34.1  -1.9   22   72-93     40-62  (502)
142 cd05061 PTKc_InsR Catalytic do  84.0    0.81 1.8E-05   28.7   1.8   16   71-86     12-27  (288)
143 cd06643 STKc_SLK Catalytic dom  84.0     1.2 2.6E-05   27.7   2.5   18   71-88     11-28  (282)
144 cd07865 STKc_CDK9 Catalytic do  83.9     1.1 2.3E-05   28.2   2.3   21   72-92     19-40  (310)
145 cd05050 PTKc_Musk Catalytic do  83.8    0.82 1.8E-05   28.6   1.8   16   72-87     12-27  (288)
146 cd05051 PTKc_DDR Catalytic dom  83.7    0.86 1.9E-05   28.5   1.8   18   71-88     11-28  (296)
147 cd06635 STKc_TAO1 Catalytic do  83.7     1.1 2.5E-05   28.5   2.4   21   72-92     32-53  (317)
148 cd05032 PTKc_InsR_like Catalyt  83.2    0.95 2.1E-05   28.0   1.9   17   71-87     12-28  (277)
149 cd05079 PTKc_Jak1_rpt2 Catalyt  83.2     1.1 2.3E-05   28.1   2.1   16   71-86     10-25  (284)
150 cd05062 PTKc_IGF-1R Catalytic   83.1    0.77 1.7E-05   28.5   1.4   15   72-86     13-27  (277)
151 KOG1235 Predicted unusual prot  83.1    0.98 2.1E-05   31.8   2.0   26   68-93    163-189 (538)
152 KOG0694 Serine/threonine prote  83.0       1 2.2E-05   32.5   2.0   16   72-87    375-390 (694)
153 cd05056 PTKc_FAK Catalytic dom  82.9       1 2.2E-05   27.8   1.9   19   70-88     11-29  (270)
154 cd07874 STKc_JNK3 Catalytic do  82.9     1.1 2.4E-05   29.1   2.1   15   72-86     24-38  (355)
155 cd06640 STKc_MST4 Catalytic do  82.9     1.4   3E-05   27.4   2.5   22   71-92     10-32  (277)
156 KOG0197 Tyrosine kinases [Sign  82.8    0.98 2.1E-05   31.2   1.9   22   71-92    212-233 (468)
157 cd06659 STKc_PAK6 Catalytic do  82.6     1.3 2.8E-05   28.0   2.3   21   72-92     28-49  (297)
158 cd06633 STKc_TAO3 Catalytic do  82.5     1.3 2.9E-05   28.2   2.4   20   72-91     28-48  (313)
159 cd05610 STKc_MASTL Catalytic d  82.5     1.2 2.5E-05   32.0   2.3   22   71-92     10-32  (669)
160 cd06612 STKc_MST1_2 Catalytic   82.2     1.4   3E-05   26.8   2.3   18   71-88      9-26  (256)
161 cd05097 PTKc_DDR_like Catalyti  82.1    0.85 1.8E-05   28.7   1.4   17   71-87     11-27  (295)
162 cd07875 STKc_JNK1 Catalytic do  82.1     1.3 2.8E-05   28.9   2.3   15   72-86     31-45  (364)
163 cd07866 STKc_BUR1 Catalytic do  82.0     1.4   3E-05   27.7   2.3   20   72-91     15-35  (311)
164 cd05092 PTKc_TrkA Catalytic do  81.9     1.1 2.4E-05   27.9   1.8   17   70-86     10-26  (280)
165 cd06654 STKc_PAK1 Catalytic do  81.8     1.3 2.9E-05   27.9   2.2   21   72-92     27-48  (296)
166 PHA03211 serine/threonine kina  81.7     1.4   3E-05   30.3   2.3   17   72-88    176-192 (461)
167 KOG0598 Ribosomal protein S6 k  81.5    0.92   2E-05   30.2   1.3   16   72-87     32-47  (357)
168 cd07858 STKc_TEY_MAPK_plant Ca  81.2     1.5 3.2E-05   28.3   2.2   21   72-92     12-33  (337)
169 PF09919 DUF2149:  Uncharacteri  81.1     1.5 3.2E-05   23.6   1.8   17   74-92     71-88  (92)
170 PTZ00370 STEVOR; Provisional    80.2    0.84 1.8E-05   29.5   0.8    9   13-21    274-282 (296)
171 cd06647 STKc_PAK_I Catalytic d  80.1     1.6 3.5E-05   27.5   2.1   21   71-91     25-46  (293)
172 KOG0667 Dual-specificity tyros  80.0     1.4 2.9E-05   31.4   1.8   22   72-93    193-215 (586)
173 KOG0199 ACK and related non-re  80.0     1.1 2.5E-05   32.9   1.5   22   70-91    115-138 (1039)
174 cd05083 PTKc_Chk Catalytic dom  80.0     1.2 2.7E-05   27.2   1.5   18   71-88     12-29  (254)
175 cd06614 STKc_PAK Catalytic dom  79.8     1.4   3E-05   27.5   1.8   20   72-91     26-46  (286)
176 cd05098 PTKc_FGFR1 Catalytic d  79.8     1.3 2.8E-05   28.1   1.6   16   71-86     24-39  (307)
177 KOG4257 Focal adhesion tyrosin  79.5     1.1 2.3E-05   32.7   1.2   17   70-86    394-410 (974)
178 cd06658 STKc_PAK5 Catalytic do  79.4       2 4.4E-05   27.1   2.4   21   72-92     29-50  (292)
179 cd06611 STKc_SLK_like Catalyti  79.2     1.9 4.1E-05   26.8   2.2   22   71-92     11-33  (280)
180 PTZ00370 STEVOR; Provisional    79.1    0.77 1.7E-05   29.7   0.4   26    3-28    261-286 (296)
181 PF02009 Rifin_STEVOR:  Rifin/s  79.1     0.7 1.5E-05   30.1   0.2    8   12-19    273-280 (299)
182 cd07855 STKc_ERK5 Catalytic do  78.8     1.9 4.2E-05   27.7   2.2   22   71-92     11-33  (334)
183 KOG0666 Cyclin C-dependent kin  78.5     1.6 3.4E-05   29.2   1.7   16   72-87     31-46  (438)
184 cd05095 PTKc_DDR2 Catalytic do  78.5     1.1 2.5E-05   28.1   1.1   15   71-85     11-25  (296)
185 KOG1024 Receptor-like protein   78.4     2.7 5.9E-05   29.0   2.8   17   72-88    291-307 (563)
186 cd07850 STKc_JNK Catalytic dom  78.1     2.2 4.8E-05   27.7   2.3   21   72-92     23-44  (353)
187 cd05053 PTKc_FGFR Catalytic do  77.9     1.6 3.4E-05   27.3   1.6   16   72-87     19-34  (293)
188 PF05568 ASFV_J13L:  African sw  77.1     1.3 2.8E-05   25.9   0.9   15    9-23     44-58  (189)
189 cd05093 PTKc_TrkB Catalytic do  77.1     2.2 4.7E-05   26.8   2.0   16   71-86     11-26  (288)
190 PHA03390 pk1 serine/threonine-  77.0     4.5 9.7E-05   25.1   3.4   15   73-87     24-38  (267)
191 KOG0584 Serine/threonine prote  76.9    0.99 2.1E-05   32.2   0.5   25   69-93     44-69  (632)
192 cd06634 STKc_TAO2 Catalytic do  76.6     2.5 5.4E-05   26.9   2.2   20   72-91     22-42  (308)
193 cd06608 STKc_myosinIII_like Ca  76.4     1.4 3.1E-05   27.0   1.1   16   72-87     13-28  (275)
194 KOG0986 G protein-coupled rece  76.0     1.8 3.9E-05   30.2   1.5   20   68-87    186-207 (591)
195 cd06648 STKc_PAK_II Catalytic   75.9     2.5 5.5E-05   26.5   2.1   20   72-91     26-46  (285)
196 cd05101 PTKc_FGFR2 Catalytic d  75.9     1.8   4E-05   27.3   1.5   16   71-86     21-36  (304)
197 KOG4258 Insulin/growth factor   75.1     7.2 0.00016   29.4   4.3   15   72-86   1001-1015(1025)
198 cd06655 STKc_PAK2 Catalytic do  74.8       3 6.5E-05   26.4   2.2   21   72-92     26-47  (296)
199 cd05066 PTKc_EphR_A Catalytic   74.5     2.3 5.1E-05   26.2   1.7   17   70-86      9-25  (267)
200 cd05055 PTKc_PDGFR Catalytic d  74.4     2.1 4.6E-05   27.1   1.5   16   71-86     41-56  (302)
201 KOG1989 ARK protein kinase fam  74.2     2.9 6.3E-05   30.7   2.2   18   72-89     44-61  (738)
202 cd05080 PTKc_Tyk2_rpt2 Catalyt  74.1       2 4.4E-05   26.7   1.3   16   70-85      9-24  (283)
203 PF05454 DAG1:  Dystroglycan (D  73.8     1.1 2.3E-05   29.2   0.0   12   12-23    164-175 (290)
204 KOG0592 3-phosphoinositide-dep  73.7     2.2 4.7E-05   30.3   1.5   18   69-86     77-94  (604)
205 KOG1167 Serine/threonine prote  73.4     0.9   2E-05   30.8  -0.4   16   72-87     43-58  (418)
206 cd05100 PTKc_FGFR3 Catalytic d  73.2     2.3   5E-05   27.3   1.5   16   71-86     18-33  (334)
207 PF14991 MLANA:  Protein melan-  73.2     1.1 2.5E-05   24.9   0.1    7   15-21     44-50  (118)
208 cd05099 PTKc_FGFR4 Catalytic d  73.0     2.4 5.1E-05   27.0   1.5   16   71-86     18-33  (314)
209 KOG0583 Serine/threonine prote  72.7     3.3 7.2E-05   27.7   2.1   22   72-93     24-46  (370)
210 PF07204 Orthoreo_P10:  Orthore  71.4     2.8 6.1E-05   22.6   1.3   10    9-18     56-65  (98)
211 PHA03207 serine/threonine kina  70.4       4 8.7E-05   27.1   2.1   15   72-86     99-113 (392)
212 PF11770 GAPT:  GRB2-binding ad  69.4     4.2 9.2E-05   23.9   1.8   17    3-19     16-32  (158)
213 cd05094 PTKc_TrkC Catalytic do  68.4     3.5 7.6E-05   25.8   1.5   16   71-86     11-26  (291)
214 PTZ00266 NIMA-related protein   68.1       5 0.00011   30.6   2.4   16   72-87     20-35  (1021)
215 cd06613 STKc_MAP4K3_like Catal  67.0     5.3 0.00011   24.3   2.1   17   71-87      9-25  (262)
216 PTZ00046 rifin; Provisional     66.1     3.2 6.9E-05   27.8   1.0    9   11-19    331-339 (358)
217 KOG0582 Ste20-like serine/thre  63.6     4.8  0.0001   28.1   1.4   24   70-93     31-55  (516)
218 TIGR01477 RIFIN variant surfac  63.1     3.9 8.5E-05   27.4   1.0    8   12-19    327-334 (353)
219 KOG1094 Discoidin domain recep  61.4     7.6 0.00016   28.3   2.1   25   69-93    542-566 (807)
220 KOG1165 Casein kinase (serine/  61.2     5.2 0.00011   27.1   1.3   22   72-93     35-57  (449)
221 KOG0660 Mitogen-activated prot  61.0     8.9 0.00019   25.8   2.3   22   72-93     29-51  (359)
222 KOG0579 Ste20-like serine/thre  58.3     2.1 4.6E-05   31.4  -0.9   16   72-87     39-54  (1187)
223 PTZ00267 NIMA-related protein   57.9     6.2 0.00013   27.1   1.3   16   71-86     73-88  (478)
224 COG2112 Predicted Ser/Thr prot  57.2     9.5 0.00021   23.5   1.8   19   72-90     29-47  (201)
225 KOG1236 Predicted unusual prot  56.3     2.6 5.6E-05   29.4  -0.7   24   63-86    186-210 (565)
226 KOG4279 Serine/threonine prote  55.1     9.3  0.0002   28.7   1.8   16   72-87    582-597 (1226)
227 KOG0596 Dual specificity; seri  53.5     9.6 0.00021   27.5   1.6   20   72-91    368-387 (677)
228 COG0478 RIO-like serine/threon  52.7      12 0.00027   24.5   1.9   24   70-93     96-119 (304)
229 KOG0200 Fibroblast/platelet-de  50.7      10 0.00022   27.1   1.4   18   70-87    301-318 (609)
230 KOG1151 Tousled-like protein k  50.6     2.2 4.7E-05   30.0  -1.8   14   72-85    470-483 (775)
231 PF15050 SCIMP:  SCIMP protein   50.5      15 0.00033   20.8   1.8    7   13-19     26-32  (133)
232 KOG0610 Putative serine/threon  48.1      17 0.00038   25.2   2.1   17   72-88     84-100 (459)
233 PF05084 GRA6:  Granule antigen  47.7      13 0.00028   22.3   1.3   21    1-21    154-174 (215)
234 KOG0664 Nemo-like MAPK-related  46.3      13 0.00029   24.6   1.3   21   72-92     60-81  (449)
235 KOG0696 Serine/threonine prote  45.6      11 0.00025   26.4   1.0   26   61-86    344-370 (683)
236 PF13095 FTA2:  Kinetochore Sim  45.0      24 0.00053   21.9   2.3   21   69-89     41-62  (207)
237 KOG4721 Serine/threonine prote  44.5      16 0.00034   26.8   1.6   19   72-90    131-149 (904)
238 PRK01723 3-deoxy-D-manno-octul  44.1      26 0.00056   21.8   2.4   20   72-91     38-58  (239)
239 KOG0616 cAMP-dependent protein  43.7      53  0.0011   22.1   3.7   16   72-87     51-66  (355)
240 cd03690 Tet_II Tet_II: This su  43.5      13 0.00029   19.2   0.9   21   72-92     16-36  (85)
241 KOG0578 p21-activated serine/t  39.4      23  0.0005   25.3   1.7   22   72-93    280-302 (550)
242 PF10577 UPF0560:  Uncharacteri  39.2      27 0.00059   26.1   2.1   15    7-21    286-300 (807)
243 PRK11486 flagellar biosynthesi  38.2      20 0.00044   20.4   1.1   17    5-21     26-42  (124)
244 KOG0669 Cyclin T-dependent kin  36.3     3.3 7.2E-05   27.0  -2.4   17   72-88     24-40  (376)
245 TIGR01624 LRP1_Cterm LRP1 C-te  36.0      30 0.00066   16.3   1.3   13   72-88     35-47  (50)
246 cd04088 EFG_mtEFG_II EFG_mtEFG  35.7      24 0.00052   17.9   1.1   21   72-92     13-33  (83)
247 KOG0607 MAP kinase-interacting  35.4      31 0.00067   23.5   1.8   24   58-84     74-97  (463)
248 KOG1027 Serine/threonine prote  35.2      30 0.00066   26.2   1.9   21   72-93    516-537 (903)
249 cd04090 eEF2_II_snRNP Loc2 eEF  35.1      27 0.00058   18.4   1.3   16   77-92     19-34  (94)
250 KOG0984 Mitogen-activated prot  34.5      22 0.00047   22.7   0.9   21   72-92     53-74  (282)
251 cd04092 mtEFG2_II_like mtEFG2_  33.6      29 0.00063   17.6   1.2   21   72-92     13-33  (83)
252 PF13974 YebO:  YebO-like prote  32.9      23  0.0005   18.6   0.7    9    6-14      6-14  (80)
253 PF05142 DUF702:  Domain of unk  32.9      29 0.00063   20.5   1.2   13   72-88    136-148 (154)
254 KOG3482 Small nuclear ribonucl  32.4      31 0.00068   17.7   1.1   15   72-86     21-35  (79)
255 cd03700 eEF2_snRNP_like_II EF2  31.3      33 0.00071   18.0   1.2   19   74-92     16-34  (93)
256 PF14531 Kinase-like:  Kinase-l  31.0      44 0.00096   21.8   2.0   21   72-92     19-40  (288)
257 KOG2345 Serine/threonine prote  31.0      31 0.00068   22.5   1.2   14   72-85     28-41  (302)
258 KOG0615 Serine/threonine prote  31.0      49  0.0011   23.1   2.2   22   72-93    179-201 (475)
259 KOG0983 Mitogen-activated prot  30.5      80  0.0017   21.2   3.0   17   72-88     99-115 (391)
260 PF15345 TMEM51:  Transmembrane  30.5      51  0.0011   21.0   2.1    7   58-64    126-132 (233)
261 KOG0612 Rho-associated, coiled  30.3      37 0.00079   26.9   1.6   17   72-88     82-98  (1317)
262 cd03699 lepA_II lepA_II: This   29.5      34 0.00074   17.6   1.1   21   72-92     13-33  (86)
263 PRK15449 ferredoxin-like prote  29.3      33 0.00072   18.6   1.0   11   73-83     83-93  (95)
264 PRK10359 lipopolysaccharide co  29.3      62  0.0014   20.4   2.4   16   72-87     38-53  (232)
265 PHA03286 envelope glycoprotein  29.1      29 0.00064   24.3   0.9   11   80-90    472-482 (492)
266 PF15176 LRR19-TM:  Leucine-ric  28.3      33 0.00072   18.8   0.9   11    5-15     25-35  (102)
267 KOG4158 BRPK/PTEN-induced prot  28.2      17 0.00037   25.4  -0.2   28   56-88    153-180 (598)
268 PF11395 DUF2873:  Protein of u  27.9      54  0.0012   14.5   1.4    9   10-18     23-31  (43)
269 PRK10905 cell division protein  27.6      53  0.0011   22.0   1.9    9    2-10      3-11  (328)
270 PF07423 DUF1510:  Protein of u  26.3      66  0.0014   20.2   2.0   21   58-78    151-180 (217)
271 PRK11901 hypothetical protein;  25.9      50  0.0011   22.1   1.5   10    2-11     41-50  (327)
272 COG1504 Uncharacterized conser  25.0 1.1E+02  0.0023   17.3   2.5   30   53-82     45-76  (121)
273 cd03689 RF3_II RF3_II: this su  24.2      42 0.00092   17.3   0.9   20   73-92     15-34  (85)
274 COG3761 NADH:ubiquinone oxidor  23.8      34 0.00073   18.9   0.4   15   69-83     12-26  (118)
275 COG3190 FliO Flagellar biogene  23.6      50  0.0011   19.2   1.1   18    4-21     31-48  (137)
276 KOG0587 Traf2- and Nck-interac  22.8      61  0.0013   24.9   1.6   21   70-90     24-45  (953)
277 PHA03240 envelope glycoprotein  22.3      65  0.0014   20.4   1.5    7   12-18    225-231 (258)
278 PRK14051 negative regulator Gr  22.2      67  0.0014   18.0   1.3   18   72-89     30-47  (123)
279 PF15569 Imm21:  Immunity prote  22.0 1.5E+02  0.0032   16.0   2.6   24   56-83     11-38  (91)
280 KOG0611 Predicted serine/threo  21.3      53  0.0011   23.2   1.0   24   70-93     58-82  (668)
281 KOG0033 Ca2+/calmodulin-depend  21.2      13 0.00028   24.3  -1.7   15   71-85     17-31  (355)
282 KOG4645 MAPKKK (MAP kinase kin  21.1      70  0.0015   25.9   1.7   19   72-90   1242-1261(1509)

No 1  
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=99.05  E-value=1.9e-10  Score=75.02  Aligned_cols=41  Identities=46%  Similarity=0.929  Sum_probs=37.1

Q ss_pred             CCceechHHHHHHhcchhc--cccccCceeeeEEEeCCCeeeC
Q 048032           53 APKRYSFPNVKKMTNSFKD--ELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        53 ~~~~~~~~~l~~at~~f~~--~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      ..+.|++.+|.+||++|++  .||+|+||.||||.+++|..||
T Consensus        61 ~~~~fs~~el~~AT~~Fs~~~~ig~Ggfg~VYkG~l~~~~~vA  103 (361)
T KOG1187|consen   61 PLRSFSYDELRKATNNFSESNLIGEGGFGTVYKGVLSDGTVVA  103 (361)
T ss_pred             CcceeeHHHHHHHHhCCchhcceecCCCeEEEEEEECCCCEEE
Confidence            5677999999999999996  8999999999999999987664


No 2  
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms]
Probab=97.58  E-value=4.6e-05  Score=54.71  Aligned_cols=20  Identities=45%  Similarity=0.880  Sum_probs=17.3

Q ss_pred             cccccCceeeeEEEe-CCCee
Q 048032           72 ELGQGGYGRVYKGKL-SDGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~   91 (93)
                      +||+|.||+||||.+ |.|+.
T Consensus       703 vLGsgAfGtV~kGiw~Pege~  723 (1177)
T KOG1025|consen  703 VLGSGAFGTVYKGIWIPEGEN  723 (1177)
T ss_pred             eeccccceeEEeeeEecCCce
Confidence            899999999999987 66654


No 3  
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=97.56  E-value=0.00011  Score=53.29  Aligned_cols=37  Identities=19%  Similarity=0.338  Sum_probs=24.4

Q ss_pred             eechHHHHHHhcchhccccccCceeeeEEEe-CCCeeeC
Q 048032           56 RYSFPNVKKMTNSFKDELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        56 ~~~~~~l~~at~~f~~~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .++++++..... ..++||+|+||.||+|.. .+|..||
T Consensus       682 ~~~~~~~~~~~~-~~~~ig~G~~g~Vy~~~~~~~~~~va  719 (968)
T PLN00113        682 SITINDILSSLK-EENVISRGKKGASYKGKSIKNGMQFV  719 (968)
T ss_pred             hhhHHHHHhhCC-cccEEccCCCeeEEEEEECCCCcEEE
Confidence            355566554432 122799999999999987 4565543


No 4  
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]
Probab=97.55  E-value=1.6e-05  Score=53.60  Aligned_cols=23  Identities=43%  Similarity=0.836  Sum_probs=18.7

Q ss_pred             hccccccCceeeeEEEeCCCeeeC
Q 048032           70 KDELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      .++||+|+||.||||.|.+ +.||
T Consensus       215 ~eli~~Grfg~V~KaqL~~-~~VA  237 (534)
T KOG3653|consen  215 LELIGRGRFGCVWKAQLDN-RLVA  237 (534)
T ss_pred             HHHhhcCccceeehhhccC-ceeE
Confidence            4489999999999999965 4444


No 5  
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]
Probab=97.01  E-value=0.00099  Score=47.87  Aligned_cols=34  Identities=21%  Similarity=0.512  Sum_probs=27.1

Q ss_pred             CceechHHHHHHhcchhc-----------cccccCceeeeEEEeC
Q 048032           54 PKRYSFPNVKKMTNSFKD-----------ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        54 ~~~~~~~~l~~at~~f~~-----------~iG~G~~g~VYk~~l~   87 (93)
                      ...++|+|-.+|...|+.           +||.|.||.||+|.|.
T Consensus       607 iDP~TYEDPnqAvreFakEId~s~i~Ie~VIGaGEFGEVc~GrLk  651 (996)
T KOG0196|consen  607 IDPHTYEDPNQAVREFAKEIDPSCVKIEKVIGAGEFGEVCSGRLK  651 (996)
T ss_pred             cCCccccCccHHHHHhhhhcChhheEEEEEEecccccceeccccc
Confidence            345788888788777742           5999999999999983


No 6  
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms]
Probab=96.63  E-value=0.0057  Score=41.49  Aligned_cols=19  Identities=26%  Similarity=0.816  Sum_probs=16.2

Q ss_pred             ccccccCceeeeEEEeCCC
Q 048032           71 DELGQGGYGRVYKGKLSDG   89 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g   89 (93)
                      +.||+|.||.|.+|.+.+.
T Consensus       217 e~IGkGRyGEVwrG~wrGe  235 (513)
T KOG2052|consen  217 EIIGKGRFGEVWRGRWRGE  235 (513)
T ss_pred             EEecCccccceeeccccCC
Confidence            4699999999999999543


No 7  
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=96.02  E-value=0.0033  Score=38.93  Aligned_cols=27  Identities=26%  Similarity=0.385  Sum_probs=21.2

Q ss_pred             HHHHhcchhc--cccccCceeeeEEEeCC
Q 048032           62 VKKMTNSFKD--ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        62 l~~at~~f~~--~iG~G~~g~VYk~~l~~   88 (93)
                      ++.+++++..  .||+|+||.||+|...+
T Consensus         3 ~~~~~~~~~~~~~lg~g~~g~v~~~~~~~   31 (268)
T cd06624           3 YEYEYDENGERVVLGKGTYGIVYAARDLS   31 (268)
T ss_pred             cccccccCCceEEEecCCceEEEEeEecC
Confidence            4556677665  79999999999998653


No 8  
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=95.91  E-value=0.0054  Score=42.28  Aligned_cols=21  Identities=29%  Similarity=0.705  Sum_probs=16.9

Q ss_pred             hcchhc--cccccCceeeeEEEe
Q 048032           66 TNSFKD--ELGQGGYGRVYKGKL   86 (93)
Q Consensus        66 t~~f~~--~iG~G~~g~VYk~~l   86 (93)
                      .++|..  .||+|+||.||+|.+
T Consensus       144 ~d~F~i~~~LG~GgFG~VYkG~~  166 (507)
T PLN03224        144 SDDFQLRDKLGGGNFGITFEGLR  166 (507)
T ss_pred             ccCceEeeEeecCCCeEEEEEEe
Confidence            345654  799999999999975


No 9  
>PF03109 ABC1:  ABC1 family;  InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli []. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex [] and E. coli AarF is required for ubiquinone production []. It has been suggested that members of the ABC1 family are novel chaperonins []. These proteins are unrelated to the ABC transporter proteins.
Probab=95.55  E-value=0.006  Score=34.14  Aligned_cols=26  Identities=31%  Similarity=0.505  Sum_probs=22.0

Q ss_pred             chhc-cccccCceeeeEEEeCCCeeeC
Q 048032           68 SFKD-ELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        68 ~f~~-~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      .|.+ .|+.++.|.||+|.|.+|+.||
T Consensus        13 ~fd~~PlasASiaQVh~a~l~~g~~Va   39 (119)
T PF03109_consen   13 EFDPEPLASASIAQVHRARLKDGEEVA   39 (119)
T ss_pred             HCCcchhhheehhhheeeeecccchhh
Confidence            3555 7999999999999999998765


No 10 
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism]
Probab=95.51  E-value=0.0091  Score=39.32  Aligned_cols=22  Identities=41%  Similarity=0.702  Sum_probs=17.7

Q ss_pred             cccccCceeeeEEEeC-CCeeeC
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~va   93 (93)
                      ++|.|+||.||+|.+. .++.||
T Consensus        31 liG~GsFg~Vyq~~~~e~~~~vA   53 (364)
T KOG0658|consen   31 LIGSGSFGVVYQAKLRETEEEVA   53 (364)
T ss_pred             EEeecccceEEEEEEcCCCceeE
Confidence            8999999999999984 344554


No 11 
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]
Probab=95.43  E-value=0.01  Score=41.70  Aligned_cols=17  Identities=35%  Similarity=1.048  Sum_probs=15.2

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|+||+||||.+-
T Consensus       398 ~rIGsGsFGtV~Rg~wh  414 (678)
T KOG0193|consen  398 ERIGSGSFGTVYRGRWH  414 (678)
T ss_pred             ceeccccccceeecccc
Confidence            47999999999999884


No 12 
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=95.39  E-value=0.012  Score=39.81  Aligned_cols=22  Identities=32%  Similarity=0.502  Sum_probs=20.2

Q ss_pred             cccccCceeeeEEEeCCCeeeC
Q 048032           72 ELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      .||+|++|.||+|.+.+|+.||
T Consensus       124 plasaSigQVh~A~l~~G~~Va  145 (437)
T TIGR01982       124 PLAAASIAQVHRARLVDGKEVA  145 (437)
T ss_pred             ceeeeehhheEEEEecCCCEEE
Confidence            6999999999999999998775


No 13 
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=95.21  E-value=0.0094  Score=38.60  Aligned_cols=22  Identities=55%  Similarity=0.987  Sum_probs=18.2

Q ss_pred             cccccCceeeeEE-EeCCCeeeC
Q 048032           72 ELGQGGYGRVYKG-KLSDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~-~l~~g~~va   93 (93)
                      .||+|.||.|||+ ++.+|..+|
T Consensus        26 ~IG~GsFg~vykv~~~~~g~l~a   48 (375)
T KOG0591|consen   26 KIGRGSFGEVYKVQCLLDGKLVA   48 (375)
T ss_pred             HHcCCcchheEEeeeccCcchhh
Confidence            7999999999997 557777654


No 14 
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]
Probab=95.21  E-value=0.016  Score=38.88  Aligned_cols=22  Identities=45%  Similarity=0.842  Sum_probs=18.1

Q ss_pred             cccccCceeeeEEEeC-CCeeeC
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~va   93 (93)
                      .||+|.|++||+|... ++..||
T Consensus        17 ~iG~GsfavVykg~h~~~~~~VA   39 (429)
T KOG0595|consen   17 EIGSGSFAVVYKGRHKKSGTEVA   39 (429)
T ss_pred             hccCcceEEEEEeEeccCCceEE
Confidence            6999999999999984 455554


No 15 
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=95.13  E-value=0.016  Score=40.50  Aligned_cols=23  Identities=39%  Similarity=0.791  Sum_probs=17.9

Q ss_pred             hcchhc--cccccCceeeeEEEeCC
Q 048032           66 TNSFKD--ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        66 t~~f~~--~iG~G~~g~VYk~~l~~   88 (93)
                      .++|..  .||+|+||.||+|...+
T Consensus       131 ~~~y~l~~~LG~G~FG~VYka~~~~  155 (566)
T PLN03225        131 KDDFVLGKKLGEGAFGVVYKASLVN  155 (566)
T ss_pred             cCCeEEeEEEeeCCCeEEEEEEEcC
Confidence            344443  79999999999999854


No 16 
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=95.13  E-value=0.013  Score=36.03  Aligned_cols=24  Identities=33%  Similarity=0.581  Sum_probs=19.6

Q ss_pred             hccccccCceeeeEEEeCCCeeeC
Q 048032           70 KDELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      .+.||+|+||.||++..+++..+|
T Consensus        11 ~~~ig~G~~g~v~~~~~~~~~~~a   34 (260)
T cd05067          11 VKKLGAGQFGEVWMGYYNGHTKVA   34 (260)
T ss_pred             eeeeccCccceEEeeecCCCceEE
Confidence            347999999999999987776553


No 17 
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=94.65  E-value=0.027  Score=33.73  Aligned_cols=23  Identities=35%  Similarity=0.489  Sum_probs=19.6

Q ss_pred             ccccccCceeeeEEEeCCCeeeC
Q 048032           71 DELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      +.||+|++|.||++..++|+.+|
T Consensus        21 ~~i~~G~~g~Vy~~~~~~g~~va   43 (198)
T cd05144          21 NQIGVGKESDVYLALDPDGNPVA   43 (198)
T ss_pred             CccccCcceEEEEEEcCCCCEEE
Confidence            47999999999999988777653


No 18 
>PHA02882 putative serine/threonine kinase; Provisional
Probab=94.54  E-value=0.027  Score=35.60  Aligned_cols=18  Identities=33%  Similarity=0.739  Sum_probs=15.6

Q ss_pred             cccccCceeeeEEEeCCC
Q 048032           72 ELGQGGYGRVYKGKLSDG   89 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g   89 (93)
                      .||+|+||.||+|...+.
T Consensus        19 ~LG~G~fG~Vy~~~~~~~   36 (294)
T PHA02882         19 LIGCGGFGCVYETQCASD   36 (294)
T ss_pred             EEecCCCceEEEEEEcCC
Confidence            799999999999987543


No 19 
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=94.40  E-value=0.019  Score=39.57  Aligned_cols=22  Identities=45%  Similarity=0.990  Sum_probs=17.8

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||+|.||.|||+.- ..|..||
T Consensus       124 kIGeGTyg~VYkAr~~~tgkivA  146 (560)
T KOG0600|consen  124 KIGEGTYGQVYKARDLETGKIVA  146 (560)
T ss_pred             HhcCcchhheeEeeecccCcEEE
Confidence            799999999999854 5676665


No 20 
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=94.27  E-value=0.046  Score=35.34  Aligned_cols=21  Identities=33%  Similarity=0.594  Sum_probs=16.9

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||+|... +|..+
T Consensus        22 ~ig~g~~g~v~~~~~~~~~~~v   43 (342)
T cd07879          22 QVGSGAYGSVCSAIDKRTGEKV   43 (342)
T ss_pred             EeeecCCeEEEEEEeCCCCcEE
Confidence            7999999999999863 45544


No 21 
>smart00090 RIO RIO-like kinase.
Probab=94.24  E-value=0.038  Score=34.44  Aligned_cols=23  Identities=22%  Similarity=0.261  Sum_probs=19.3

Q ss_pred             ccccccCceeeeEEE--eCCCeeeC
Q 048032           71 DELGQGGYGRVYKGK--LSDGRLVA   93 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~--l~~g~~va   93 (93)
                      +.||+|++|.||+|.  ..+|..||
T Consensus        34 ~~Lg~G~~g~Vy~a~~~~~~g~~va   58 (237)
T smart00090       34 GCISTGKEANVYHALDFDGSGKERA   58 (237)
T ss_pred             CeeccCcceeEEEEEecCCCCcEEE
Confidence            479999999999998  66777664


No 22 
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only]
Probab=94.15  E-value=0.038  Score=36.10  Aligned_cols=22  Identities=50%  Similarity=0.966  Sum_probs=17.6

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||+|.+|+||+|.. .+|..||
T Consensus        18 klGeGtyg~Vykar~~~~g~~VA   40 (323)
T KOG0594|consen   18 KLGEGTYGVVYKARSKRTGKFVA   40 (323)
T ss_pred             HhCCCCceEEEEEEEecCCCEEE
Confidence            699999999999977 3565554


No 23 
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=94.08  E-value=0.018  Score=36.12  Aligned_cols=36  Identities=31%  Similarity=0.609  Sum_probs=26.7

Q ss_pred             echHHHHHHhcchhc--cccccCceeeeEEEeC-CCeee
Q 048032           57 YSFPNVKKMTNSFKD--ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        57 ~~~~~l~~at~~f~~--~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +++.++.+++++|.-  .||+|++|.||++... ++..+
T Consensus        12 ~~~~~~~~~~~~y~~~~~l~~g~~~~vy~~~~~~~~~~~   50 (291)
T cd06639          12 LGLESLGDPTDTWEIIETIGKGTYGKVYKVTNKKDGSLA   50 (291)
T ss_pred             hhcccCCCCCCCeEEEEEeecCCCeEEEEEEECCCCCEE
Confidence            555667777777764  7999999999999874 44443


No 24 
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=93.98  E-value=0.028  Score=35.06  Aligned_cols=35  Identities=23%  Similarity=0.494  Sum_probs=24.8

Q ss_pred             echHHHHHHhcchhc--cccccCceeeeEEEeC-CCee
Q 048032           57 YSFPNVKKMTNSFKD--ELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        57 ~~~~~l~~at~~f~~--~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      +.++.+..++++|.-  .||+|++|.||++... ++..
T Consensus         8 ~~~~~~~~~~~~~~~~~~lg~g~~~~vy~~~~~~~~~~   45 (286)
T cd06638           8 IIFDSFPDPSDTWEIIETIGKGTYGKVFKVLNKKNGSK   45 (286)
T ss_pred             EEeecCCCcccceeeeeeeccCCCcEEEEEEECCCCce
Confidence            445556666666653  7999999999999774 3443


No 25 
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=93.72  E-value=0.049  Score=33.76  Aligned_cols=17  Identities=35%  Similarity=0.751  Sum_probs=14.9

Q ss_pred             hccccccCceeeeEEEe
Q 048032           70 KDELGQGGYGRVYKGKL   86 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l   86 (93)
                      .+.||+|+||.||+|.+
T Consensus        10 ~~~ig~G~fg~V~~~~~   26 (266)
T cd05064          10 ERILGTGRFGELCRGCL   26 (266)
T ss_pred             eeeecccCCCeEEEEEE
Confidence            34799999999999976


No 26 
>PRK09188 serine/threonine protein kinase; Provisional
Probab=93.65  E-value=0.055  Score=35.98  Aligned_cols=21  Identities=19%  Similarity=0.289  Sum_probs=17.0

Q ss_pred             cccccCceeeeEEEeC--CCeee
Q 048032           72 ELGQGGYGRVYKGKLS--DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~--~g~~v   92 (93)
                      .||+|+||.||++...  +++.+
T Consensus        25 ~IG~G~fg~Vy~a~~~~~~~~~v   47 (365)
T PRK09188         25 VLKRDVFSTVERGYFAGDPGTAR   47 (365)
T ss_pred             EEeecCcEEEEEEEEcCCCCeEE
Confidence            7999999999999764  45543


No 27 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=93.62  E-value=0.042  Score=28.36  Aligned_cols=20  Identities=10%  Similarity=0.283  Sum_probs=14.4

Q ss_pred             CceechHHHHHHhcchhccc
Q 048032           54 PKRYSFPNVKKMTNSFKDEL   73 (93)
Q Consensus        54 ~~~~~~~~l~~at~~f~~~i   73 (93)
                      ....||+|..+|...|+..|
T Consensus        54 IDP~TYEDP~qAV~eFAkEI   73 (75)
T PF14575_consen   54 IDPHTYEDPNQAVREFAKEI   73 (75)
T ss_dssp             --GGGSSSHHHHHHHCSSB-
T ss_pred             cCcccccCHHHHHHHHHhhc
Confidence            34678999999998887654


No 28 
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=93.60  E-value=0.06  Score=33.10  Aligned_cols=22  Identities=32%  Similarity=0.682  Sum_probs=18.2

Q ss_pred             ccccccCceeeeEEEeCCCeee
Q 048032           71 DELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      +.||+|++|.||+|..+++..+
T Consensus        12 ~~lg~g~~g~v~~~~~~~~~~v   33 (261)
T cd05072          12 KKLGAGQFGEVWMGYYNNSTKV   33 (261)
T ss_pred             eecCCcCCceEEEEEecCCceE
Confidence            4799999999999998766544


No 29 
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=93.59  E-value=0.035  Score=34.33  Aligned_cols=21  Identities=48%  Similarity=0.971  Sum_probs=16.5

Q ss_pred             cccccCceeeeEEEeCC-Ceee
Q 048032           72 ELGQGGYGRVYKGKLSD-GRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~-g~~v   92 (93)
                      .||+|+||.||+|...+ +..+
T Consensus        13 ~lg~g~~g~vy~~~~~~~~~~~   34 (272)
T cd06637          13 LVGNGTYGQVYKGRHVKTGQLA   34 (272)
T ss_pred             heeecCCeEEEEEEEcCCCcEE
Confidence            79999999999998743 4433


No 30 
>PTZ00284 protein kinase; Provisional
Probab=93.59  E-value=0.03  Score=37.89  Aligned_cols=29  Identities=31%  Similarity=0.405  Sum_probs=20.2

Q ss_pred             Hhcchhc--cccccCceeeeEEEeC-CCeeeC
Q 048032           65 MTNSFKD--ELGQGGYGRVYKGKLS-DGRLVA   93 (93)
Q Consensus        65 at~~f~~--~iG~G~~g~VYk~~l~-~g~~va   93 (93)
                      .++.|.-  .||+|+||.||++... .+..||
T Consensus       127 ~~~~y~i~~~lG~G~fg~V~~a~~~~~~~~vA  158 (467)
T PTZ00284        127 STQRFKILSLLGEGTFGKVVEAWDRKRKEYCA  158 (467)
T ss_pred             CCCcEEEEEEEEeccCEEEEEEEEcCCCeEEE
Confidence            3444543  7999999999999764 454443


No 31 
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=93.47  E-value=0.084  Score=34.21  Aligned_cols=35  Identities=23%  Similarity=0.401  Sum_probs=25.0

Q ss_pred             hHHHHHHhcchhc--cccccCceeeeEEEe-CCCeeeC
Q 048032           59 FPNVKKMTNSFKD--ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        59 ~~~l~~at~~f~~--~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      ..++...+++|..  .||+|+||.||++.. .+|..+|
T Consensus         9 ~~~~~~~~~~y~~~~~lg~G~~g~v~~~~~~~~~~~va   46 (345)
T cd07877           9 NKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVA   46 (345)
T ss_pred             HHHHhhccCceEEEEEeeecCCeEEEEEEEcCCCeEEE
Confidence            3455566666654  799999999999975 4565543


No 32 
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]
Probab=93.34  E-value=0.047  Score=41.29  Aligned_cols=26  Identities=46%  Similarity=0.809  Sum_probs=18.8

Q ss_pred             hcchhc--cccccCceeeeEEEeC-CCee
Q 048032           66 TNSFKD--ELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        66 t~~f~~--~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      .++|-+  ++|+||||.|||+.=. ||..
T Consensus       478 ~~DFEEL~lLGkGGFG~VvkVRNKlDGr~  506 (1351)
T KOG1035|consen  478 LNDFEELELLGKGGFGSVVKVRNKLDGRE  506 (1351)
T ss_pred             hhhhHHHHHhcCCCCceEEEEeecccchh
Confidence            345655  7999999999998642 5543


No 33 
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=93.29  E-value=0.049  Score=33.55  Aligned_cols=22  Identities=32%  Similarity=0.673  Sum_probs=18.1

Q ss_pred             ccccccCceeeeEEEeCCCeee
Q 048032           71 DELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      +.||+|++|.||++...++..+
T Consensus        12 ~~lg~g~~~~v~~~~~~~~~~v   33 (261)
T cd05068          12 RKLGAGQFGEVWEGLWNNTTPV   33 (261)
T ss_pred             EEecccCCccEEEEEecCCeEE
Confidence            4799999999999988666544


No 34 
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=93.29  E-value=0.072  Score=32.78  Aligned_cols=22  Identities=32%  Similarity=0.687  Sum_probs=18.1

Q ss_pred             ccccccCceeeeEEEeCCCeee
Q 048032           71 DELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      +.||+|++|.||++..+++..+
T Consensus        12 ~~ig~g~~~~v~~~~~~~~~~~   33 (260)
T cd05070          12 KKLGNGQFGEVWMGTWNGNTKV   33 (260)
T ss_pred             heeccccCceEEEEEecCCcee
Confidence            4799999999999988766544


No 35 
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=93.14  E-value=0.062  Score=34.79  Aligned_cols=16  Identities=31%  Similarity=0.754  Sum_probs=14.0

Q ss_pred             hccccccCceeeeEEE
Q 048032           70 KDELGQGGYGRVYKGK   85 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~   85 (93)
                      .+.||+|+||.||++.
T Consensus        12 ~~~lG~G~fg~V~~~~   27 (343)
T cd05103          12 GKPLGRGAFGQVIEAD   27 (343)
T ss_pred             cccccCCccceEEEEe
Confidence            3489999999999986


No 36 
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=92.85  E-value=0.088  Score=32.31  Aligned_cols=22  Identities=32%  Similarity=0.638  Sum_probs=17.7

Q ss_pred             ccccccCceeeeEEEeCCCeee
Q 048032           71 DELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      +.||+|++|.||++..+++..+
T Consensus        12 ~~ig~g~~~~v~~~~~~~~~~~   33 (261)
T cd05034          12 RKLGAGQFGEVWMGTWNGTTKV   33 (261)
T ss_pred             eeeccCcceEEEEEEEcCCceE
Confidence            3799999999999987665443


No 37 
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=92.81  E-value=0.082  Score=32.46  Aligned_cols=21  Identities=38%  Similarity=0.515  Sum_probs=17.4

Q ss_pred             ccccccCceeeeEEEeCCCee
Q 048032           71 DELGQGGYGRVYKGKLSDGRL   91 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~   91 (93)
                      +.||+|+||.||++...++..
T Consensus        10 ~~lg~G~~~~vy~~~~~~~~~   30 (256)
T cd05114          10 KELGSGQFGVVHLGKWRAQIK   30 (256)
T ss_pred             eEecCCcCceEEEEEeccCce
Confidence            479999999999998866543


No 38 
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=92.75  E-value=0.088  Score=32.80  Aligned_cols=35  Identities=31%  Similarity=0.732  Sum_probs=22.6

Q ss_pred             chHHHHHHhcchh--ccccccCceeeeEEEeC-CCeee
Q 048032           58 SFPNVKKMTNSFK--DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        58 ~~~~l~~at~~f~--~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      ++.++..+.+.|.  +.||.|+||.||++... ++..+
T Consensus         7 ~~~~~~~~~~~~~~~~~lg~g~~~~v~~~~~~~~~~~~   44 (282)
T cd06636           7 DLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLA   44 (282)
T ss_pred             hhhhhcChhhhhhhheeeccCCCeEEEEEEEcCCCcEE
Confidence            3444444444443  37999999999999874 34433


No 39 
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=92.74  E-value=0.082  Score=32.37  Aligned_cols=22  Identities=32%  Similarity=0.589  Sum_probs=17.6

Q ss_pred             hccccccCceeeeEEEeCCCee
Q 048032           70 KDELGQGGYGRVYKGKLSDGRL   91 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~~g~~   91 (93)
                      .+.||+|++|.||++...++..
T Consensus         9 ~~~ig~g~~g~v~~~~~~~~~~   30 (256)
T cd05112           9 VQEIGSGQFGLVWLGYWLEKRK   30 (256)
T ss_pred             EeeecCcccceEEEEEEeCCCe
Confidence            4479999999999998765543


No 40 
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=92.47  E-value=0.14  Score=35.76  Aligned_cols=22  Identities=32%  Similarity=0.430  Sum_probs=19.7

Q ss_pred             cccccCceeeeEEEeCC-CeeeC
Q 048032           72 ELGQGGYGRVYKGKLSD-GRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~-g~~va   93 (93)
                      .||+|++|.||++.+.+ |+.||
T Consensus       126 PlasaSiaQVh~A~l~~~G~~VA  148 (537)
T PRK04750        126 PLASASIAQVHFARLKDNGREVV  148 (537)
T ss_pred             hhcCCCccEEEEEEECCCCCEEE
Confidence            69999999999999987 88765


No 41 
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=92.46  E-value=0.098  Score=33.08  Aligned_cols=18  Identities=28%  Similarity=0.652  Sum_probs=15.2

Q ss_pred             ccccccCceeeeEEEeCC
Q 048032           71 DELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~   88 (93)
                      +.||+|+||.||++..++
T Consensus        11 ~~lg~G~fg~V~~~~~~~   28 (304)
T cd05096          11 EKLGEGQFGEVHLCEVVN   28 (304)
T ss_pred             eEecccCCeEEEEEEecc
Confidence            479999999999997643


No 42 
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only]
Probab=92.39  E-value=0.069  Score=35.45  Aligned_cols=22  Identities=36%  Similarity=0.679  Sum_probs=17.0

Q ss_pred             cccccCceeeeEEEeC-CCeeeC
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~va   93 (93)
                      .|++|.||.||||.-. .++.||
T Consensus        83 rI~EGtyGiVYRakdk~t~eIVA  105 (419)
T KOG0663|consen   83 RIEEGTYGVVYRAKDKKTDEIVA  105 (419)
T ss_pred             hcccCcceeEEEeccCCcceeEE
Confidence            6999999999999763 444454


No 43 
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms]
Probab=92.37  E-value=0.073  Score=38.09  Aligned_cols=23  Identities=52%  Similarity=1.097  Sum_probs=18.7

Q ss_pred             ccccccCceeeeEEEe-CCCeeeC
Q 048032           71 DELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      +.+|+|+||.||+|.- ..|..||
T Consensus        19 e~LG~Ga~g~V~rgrnketG~~vA   42 (732)
T KOG4250|consen   19 ERLGKGAFGNVYRGRNKETGRLVA   42 (732)
T ss_pred             hhhcCCccceeeeecccccccchh
Confidence            4799999999999984 5676665


No 44 
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=92.36  E-value=0.097  Score=32.56  Aligned_cols=18  Identities=44%  Similarity=0.852  Sum_probs=15.8

Q ss_pred             ccccccCceeeeEEEeCC
Q 048032           71 DELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~   88 (93)
                      +.||+|+||.||+|...+
T Consensus        12 ~~i~~g~~g~V~~~~~~~   29 (280)
T cd05043          12 DLLQEGTFGRIFYGILID   29 (280)
T ss_pred             eeecccCCceEEEEEEec
Confidence            489999999999998754


No 45 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=92.30  E-value=0.11  Score=35.09  Aligned_cols=22  Identities=32%  Similarity=0.548  Sum_probs=17.4

Q ss_pred             cccccCceeeeEEEeC-CCeeeC
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~va   93 (93)
                      .||+|+||.||+|... ++..+|
T Consensus        73 ~LG~G~fg~Vy~~~~~~~~~~vA   95 (440)
T PTZ00036         73 IIGNGSFGVVYEAICIDTSEKVA   95 (440)
T ss_pred             EEEeCCCEEEEEEEECCCCCEEE
Confidence            6999999999999874 455543


No 46 
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=92.26  E-value=0.099  Score=33.32  Aligned_cols=16  Identities=50%  Similarity=0.914  Sum_probs=14.5

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|+||.||+|...
T Consensus        14 ~lg~G~~g~Vy~~~~~   29 (316)
T cd05108          14 VLGSGAFGTVYKGLWI   29 (316)
T ss_pred             eeecCCCceEEEEEEe
Confidence            7999999999999863


No 47 
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=92.21  E-value=0.088  Score=33.82  Aligned_cols=16  Identities=31%  Similarity=0.725  Sum_probs=14.1

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||++..
T Consensus        13 ~~lG~G~fg~Vy~~~~   28 (338)
T cd05102          13 KVLGHGAFGKVVEASA   28 (338)
T ss_pred             eEeccCCcceEEEEEE
Confidence            4799999999999974


No 48 
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=92.21  E-value=0.11  Score=35.78  Aligned_cols=22  Identities=45%  Similarity=0.557  Sum_probs=17.5

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||+|+||+||++.. .+|..+|
T Consensus        39 ~LG~G~fG~Vy~a~~~~~g~~vA   61 (496)
T PTZ00283         39 VLGSGATGTVLCAKRVSDGEPFA   61 (496)
T ss_pred             EEecCCCEEEEEEEEcCCCCEEE
Confidence            799999999999975 4565553


No 49 
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=92.19  E-value=0.21  Score=31.18  Aligned_cols=21  Identities=33%  Similarity=0.670  Sum_probs=16.4

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|+||.||++... +|..+
T Consensus        11 ~lg~G~~g~vy~~~~~~~~~~~   32 (288)
T cd06616          11 EIGRGAFGTVNKMLHKPSGTIM   32 (288)
T ss_pred             HhCCCCceEEEEEEECCCCCEE
Confidence            7999999999998764 34443


No 50 
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]
Probab=92.16  E-value=0.12  Score=34.32  Aligned_cols=19  Identities=47%  Similarity=0.866  Sum_probs=16.1

Q ss_pred             cccccCceeeeEEEeCCCe
Q 048032           72 ELGQGGYGRVYKGKLSDGR   90 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~   90 (93)
                      .||+|+||+||+|.+.+-.
T Consensus        48 ~iG~G~~g~V~~~~~~g~~   66 (362)
T KOG0192|consen   48 VLGSGSFGTVYKGKWRGTD   66 (362)
T ss_pred             hcccCCceeEEEEEeCCce
Confidence            6999999999999995433


No 51 
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=92.09  E-value=0.1  Score=32.12  Aligned_cols=21  Identities=24%  Similarity=0.544  Sum_probs=17.2

Q ss_pred             ccccccCceeeeEEEeCCCee
Q 048032           71 DELGQGGYGRVYKGKLSDGRL   91 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~   91 (93)
                      +.||+|++|.||++...++..
T Consensus        12 ~~lg~g~~~~vy~~~~~~~~~   32 (260)
T cd05073          12 KKLGAGQFGEVWMATYNKHTK   32 (260)
T ss_pred             eEecCccceEEEEEEecCCcc
Confidence            479999999999998765543


No 52 
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=92.03  E-value=0.12  Score=31.90  Aligned_cols=18  Identities=33%  Similarity=0.835  Sum_probs=15.7

Q ss_pred             hccccccCceeeeEEEeC
Q 048032           70 KDELGQGGYGRVYKGKLS   87 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~   87 (93)
                      .+.||+|+||.||+|.+.
T Consensus         9 ~~~lg~g~~g~vy~~~~~   26 (266)
T cd05033           9 EKVIGGGEFGEVCRGRLK   26 (266)
T ss_pred             eeEecCCccceEEEEEEc
Confidence            448999999999999884


No 53 
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=92.00  E-value=0.12  Score=31.97  Aligned_cols=22  Identities=36%  Similarity=0.626  Sum_probs=17.4

Q ss_pred             ccccccCceeeeEEEeCCCeee
Q 048032           71 DELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      +.||+|++|.||++..++...+
T Consensus        12 ~~lg~g~~~~v~~~~~~~~~~v   33 (262)
T cd05071          12 VKLGQGCFGEVWMGTWNGTTRV   33 (262)
T ss_pred             eecCCCCCCcEEEEEecCCceE
Confidence            4799999999999987654333


No 54 
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=91.90  E-value=0.11  Score=35.37  Aligned_cols=16  Identities=38%  Similarity=0.806  Sum_probs=14.4

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|.||.||||.-
T Consensus        19 ~~IgrGsfG~Vyk~~d   34 (467)
T KOG0201|consen   19 ELIGRGSFGEVYKAID   34 (467)
T ss_pred             hhccccccceeeeeee
Confidence            3799999999999975


No 55 
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=91.80  E-value=0.13  Score=33.82  Aligned_cols=16  Identities=31%  Similarity=0.733  Sum_probs=14.1

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||++..
T Consensus        41 ~~LG~G~fG~V~~~~~   56 (375)
T cd05104          41 KTLGAGAFGKVVEATA   56 (375)
T ss_pred             heecCCccceEEEEEE
Confidence            4899999999999864


No 56 
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms]
Probab=91.62  E-value=0.16  Score=35.97  Aligned_cols=26  Identities=54%  Similarity=0.851  Sum_probs=20.3

Q ss_pred             chhc-cccccCceeeeEEEeC-CCeeeC
Q 048032           68 SFKD-ELGQGGYGRVYKGKLS-DGRLVA   93 (93)
Q Consensus        68 ~f~~-~iG~G~~g~VYk~~l~-~g~~va   93 (93)
                      -|++ ++|+|-||+||-|.-. +|+.||
T Consensus       566 if~devLGSGQFG~VYgg~hRktGrdVA  593 (888)
T KOG4236|consen  566 IFADEVLGSGQFGTVYGGKHRKTGRDVA  593 (888)
T ss_pred             hhhHhhccCCcceeeecceecccCceee
Confidence            3555 8999999999998773 566664


No 57 
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=91.48  E-value=0.13  Score=31.57  Aligned_cols=22  Identities=32%  Similarity=0.598  Sum_probs=17.9

Q ss_pred             ccccccCceeeeEEEeCCCeee
Q 048032           71 DELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      +.||.|++|.||++...++..+
T Consensus        12 ~~ig~g~~~~vy~~~~~~~~~~   33 (261)
T cd05148          12 RKLGSGYFGEVWEGLWKNRVRV   33 (261)
T ss_pred             hhhccCCCccEEEeEecCCCcE
Confidence            3799999999999988665443


No 58 
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=91.29  E-value=0.15  Score=38.00  Aligned_cols=22  Identities=55%  Similarity=1.023  Sum_probs=19.4

Q ss_pred             cccccCceeeeEEEeCCCeeeC
Q 048032           72 ELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      .||+|++|+||+|.-.+|..+|
T Consensus       705 e~G~g~y~~vy~a~~~~~~~~a  726 (974)
T KOG1166|consen  705 EIGEGSYGSVYVATHSNGKLVA  726 (974)
T ss_pred             eeccccceEEEEeecCCCcEEE
Confidence            6999999999999988887665


No 59 
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=91.15  E-value=0.2  Score=32.55  Aligned_cols=21  Identities=43%  Similarity=0.645  Sum_probs=17.0

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|+||.||++... +|..+
T Consensus        81 ~lg~G~~g~V~~~~~~~~~~~v  102 (353)
T PLN00034         81 RIGSGAGGTVYKVIHRPTGRLY  102 (353)
T ss_pred             hccCCCCeEEEEEEECCCCCEE
Confidence            7999999999999864 45544


No 60 
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only]
Probab=91.11  E-value=0.21  Score=34.84  Aligned_cols=22  Identities=27%  Similarity=0.607  Sum_probs=16.9

Q ss_pred             cccccCceeeeEEEeC-CCeeeC
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~va   93 (93)
                      +||+|+||.||.+.-. .|...|
T Consensus       148 ~IgkGAfGeVrLarKk~Tg~iyA  170 (550)
T KOG0605|consen  148 VIGKGAFGEVRLARKKDTGEIYA  170 (550)
T ss_pred             eeccccceeEEEEEEccCCcEEe
Confidence            7999999999998764 354443


No 61 
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=90.97  E-value=0.36  Score=31.15  Aligned_cols=21  Identities=29%  Similarity=0.415  Sum_probs=16.5

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|+||.||++... ++..+
T Consensus        22 ~lg~G~~g~V~~~~~~~~~~~v   43 (343)
T cd07878          22 PVGSGAYGSVCSAYDTRLRQKV   43 (343)
T ss_pred             ecccCCCeEEEEEEECCCCCEE
Confidence            7999999999999763 44444


No 62 
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=90.85  E-value=0.15  Score=35.11  Aligned_cols=17  Identities=53%  Similarity=1.152  Sum_probs=15.4

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|.||.||+|.|.
T Consensus       163 kkLGeGaFGeV~~G~l~  179 (474)
T KOG0194|consen  163 KKLGEGAFGEVFKGKLK  179 (474)
T ss_pred             ceeecccccEEEEEEEE
Confidence            47999999999999984


No 63 
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]
Probab=90.74  E-value=0.37  Score=32.08  Aligned_cols=21  Identities=38%  Similarity=0.656  Sum_probs=16.7

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|..|+|||+... .+...
T Consensus        86 ~lG~G~gG~V~kv~Hk~t~~i~  107 (364)
T KOG0581|consen   86 VLGSGNGGTVYKVRHKPTGKIY  107 (364)
T ss_pred             hcccCCCcEEEEEEEcCCCeEE
Confidence            7999999999999884 44433


No 64 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=90.68  E-value=0.19  Score=32.37  Aligned_cols=22  Identities=36%  Similarity=0.665  Sum_probs=17.4

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|+||.||++... +|..+
T Consensus        24 ~~lg~G~~g~V~~~~~~~~~~~~   46 (329)
T PTZ00263         24 ETLGTGSFGRVRIAKHKGTGEYY   46 (329)
T ss_pred             EEEEecCCeEEEEEEECCCCCEE
Confidence            37999999999999885 45444


No 65 
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=90.46  E-value=0.24  Score=31.10  Aligned_cols=22  Identities=45%  Similarity=0.874  Sum_probs=17.0

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|+||.||++... ++..+
T Consensus        11 ~~lg~G~~g~Vy~~~~~~~~~~v   33 (288)
T cd07871          11 DKLGEGTYATVFKGRSKLTENLV   33 (288)
T ss_pred             eEEecCCCEEEEEEEECCCCCEE
Confidence            38999999999999764 34443


No 66 
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=90.42  E-value=0.21  Score=31.15  Aligned_cols=17  Identities=47%  Similarity=1.085  Sum_probs=14.7

Q ss_pred             hccccccCceeeeEEEe
Q 048032           70 KDELGQGGYGRVYKGKL   86 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l   86 (93)
                      .+.||+|+||.||+|..
T Consensus        10 ~~~lg~g~~g~vy~~~~   26 (283)
T cd05090          10 MEELGECAFGKIYKGHL   26 (283)
T ss_pred             eeeccccCCcceEEEEE
Confidence            34799999999999975


No 67 
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=90.27  E-value=0.2  Score=30.87  Aligned_cols=21  Identities=38%  Similarity=0.529  Sum_probs=17.0

Q ss_pred             hccccccCceeeeEEEeCCCe
Q 048032           70 KDELGQGGYGRVYKGKLSDGR   90 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~~g~   90 (93)
                      .+.||+|++|.||.+...++.
T Consensus         9 ~~~lg~G~~~~vy~~~~~~~~   29 (256)
T cd05113           9 LKELGTGQFGVVKYGKWRGQY   29 (256)
T ss_pred             eeEecCcccceEEEEEecCCC
Confidence            347999999999999876544


No 68 
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=90.22  E-value=0.25  Score=30.44  Aligned_cols=22  Identities=32%  Similarity=0.584  Sum_probs=17.6

Q ss_pred             hccccccCceeeeEEEeCCCee
Q 048032           70 KDELGQGGYGRVYKGKLSDGRL   91 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~~g~~   91 (93)
                      .+.||+|++|.||++..+++..
T Consensus        11 ~~~ig~g~~~~v~~~~~~~~~~   32 (260)
T cd05069          11 DVKLGQGCFGEVWMGTWNGTTK   32 (260)
T ss_pred             eeeecCcCCCeEEEEEEcCCce
Confidence            3479999999999998865543


No 69 
>PHA02988 hypothetical protein; Provisional
Probab=90.20  E-value=0.22  Score=31.35  Aligned_cols=35  Identities=20%  Similarity=0.278  Sum_probs=23.4

Q ss_pred             CceechHHHHHHhcchhccccccCceeeeEEEeCCCeee
Q 048032           54 PKRYSFPNVKKMTNSFKDELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        54 ~~~~~~~~l~~at~~f~~~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      .+.++.+|+...+   ...|++|+++.||+|.. +|..|
T Consensus        12 ~~~i~~~~i~~~~---~~~i~~g~~~~v~~~~~-~~~~v   46 (283)
T PHA02988         12 IKCIESDDIDKYT---SVLIKENDQNSIYKGIF-NNKEV   46 (283)
T ss_pred             ceecCHHHcCCCC---CeEEeeCCceEEEEEEE-CCEEE
Confidence            3455666663221   12799999999999998 45554


No 70 
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=90.02  E-value=0.3  Score=30.08  Aligned_cols=21  Identities=43%  Similarity=0.858  Sum_probs=17.0

Q ss_pred             cccccCceeeeEEEe-CCCeee
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~v   92 (93)
                      .||+|+||.||+|.. .+|..+
T Consensus        16 ~lg~g~~g~vy~~~~~~~~~~~   37 (267)
T cd06646          16 RVGSGTYGDVYKARNLHTGELA   37 (267)
T ss_pred             eeecCCCeEEEEEEECCCCeEE
Confidence            799999999999986 455544


No 71 
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=90.02  E-value=0.2  Score=32.51  Aligned_cols=16  Identities=31%  Similarity=0.775  Sum_probs=14.1

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||++..
T Consensus        13 ~~lG~G~fg~Vy~a~~   28 (337)
T cd05054          13 KPLGRGAFGKVIQASA   28 (337)
T ss_pred             cccccCcCceEEeccc
Confidence            4799999999999864


No 72 
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=90.02  E-value=0.23  Score=30.47  Aligned_cols=20  Identities=40%  Similarity=0.586  Sum_probs=16.5

Q ss_pred             hccccccCceeeeEEEeCCC
Q 048032           70 KDELGQGGYGRVYKGKLSDG   89 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~~g   89 (93)
                      .+.||+|++|.||++...++
T Consensus         9 ~~~lg~G~~~~v~~~~~~~~   28 (256)
T cd05059           9 LKELGSGQFGVVHLGKWRGK   28 (256)
T ss_pred             hhhhccCCCceEEEeEecCC
Confidence            44799999999999987554


No 73 
>COG0661 AarF Predicted unusual protein kinase [General function prediction only]
Probab=89.87  E-value=0.18  Score=35.16  Aligned_cols=26  Identities=23%  Similarity=0.388  Sum_probs=22.0

Q ss_pred             chhc-cccccCceeeeEEEeCCCeeeC
Q 048032           68 SFKD-ELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        68 ~f~~-~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      .|++ .|+.++.|.||+|+|.+|+.||
T Consensus       127 eF~~~PiAsASIaQVH~A~L~sG~~VA  153 (517)
T COG0661         127 EFEPEPIASASIAQVHRAVLKSGEEVA  153 (517)
T ss_pred             HcCCCchhhhhHhhheeEEecCCCEEE
Confidence            3443 6999999999999999998875


No 74 
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=89.79  E-value=0.28  Score=30.53  Aligned_cols=20  Identities=50%  Similarity=0.971  Sum_probs=16.2

Q ss_pred             ccccccCceeeeEEEe-CCCe
Q 048032           71 DELGQGGYGRVYKGKL-SDGR   90 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l-~~g~   90 (93)
                      +.||+|+||.||+|.. ++|.
T Consensus        13 ~~lg~G~~g~vy~~~~~~~~~   33 (279)
T cd05109          13 KVLGSGAFGTVYKGIWIPDGE   33 (279)
T ss_pred             eecCCCCCceEEEEEEecCCC
Confidence            3799999999999975 4554


No 75 
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=89.76  E-value=0.2  Score=32.96  Aligned_cols=16  Identities=25%  Similarity=0.530  Sum_probs=14.6

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|+||.||++...
T Consensus        50 ~lG~G~fg~Vy~~~~~   65 (371)
T cd05622          50 VIGRGAFGEVQLVRHK   65 (371)
T ss_pred             EEeecCCeEEEEEEEC
Confidence            7999999999999875


No 76 
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=89.66  E-value=0.3  Score=30.42  Aligned_cols=23  Identities=30%  Similarity=0.751  Sum_probs=17.5

Q ss_pred             hccccccCceeeeEEEeC-CCeee
Q 048032           70 KDELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .+.||.|+||.||+|... ++..+
T Consensus         9 ~~~ig~G~~~~vy~~~~~~~~~~~   32 (277)
T cd06641           9 LEKIGKGSFGEVFKGIDNRTQKVV   32 (277)
T ss_pred             heeEeecCCeEEEEEEECCCCcEE
Confidence            347999999999999763 45444


No 77 
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=89.65  E-value=0.38  Score=30.20  Aligned_cols=21  Identities=48%  Similarity=0.988  Sum_probs=17.2

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||+|... +|..+
T Consensus        14 ~lg~g~~g~v~~~~~~~~~~~v   35 (302)
T cd07864          14 QIGEGTYGQVYKARDKDTGELV   35 (302)
T ss_pred             eecccCCEEEEEEEECCCCcEE
Confidence            7999999999999985 45444


No 78 
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=89.61  E-value=0.28  Score=30.63  Aligned_cols=16  Identities=44%  Similarity=0.657  Sum_probs=14.5

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||+|..
T Consensus        13 ~~lg~G~~~~vy~~~~   28 (279)
T cd05111          13 KLLGSGVFGTVHKGIW   28 (279)
T ss_pred             cccCccCCcceEEEEE
Confidence            3799999999999986


No 79 
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=89.55  E-value=0.28  Score=30.06  Aligned_cols=19  Identities=26%  Similarity=0.609  Sum_probs=16.0

Q ss_pred             hccccccCceeeeEEEeCC
Q 048032           70 KDELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~~   88 (93)
                      .+.||+|++|.||++...+
T Consensus        11 ~~~ig~g~~g~v~~~~~~~   29 (256)
T cd05039          11 GATIGKGEFGDVMLGDYRG   29 (256)
T ss_pred             eeeeecCCCceEEEEEecC
Confidence            3489999999999998753


No 80 
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=89.33  E-value=0.34  Score=30.73  Aligned_cols=16  Identities=44%  Similarity=0.960  Sum_probs=14.5

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|+||.||++...
T Consensus        13 ~lg~G~~g~Vy~~~~~   28 (309)
T cd07872          13 KLGEGTYATVFKGRSK   28 (309)
T ss_pred             EecccCCEEEEEEEec
Confidence            7999999999999764


No 81 
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=89.20  E-value=0.28  Score=30.27  Aligned_cols=17  Identities=35%  Similarity=0.892  Sum_probs=15.2

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|++|.||++.+.
T Consensus        11 ~~lg~g~~g~vy~~~~~   27 (268)
T cd05063          11 KVIGAGEFGEVFRGILK   27 (268)
T ss_pred             eEecCCCCccEEEEEEe
Confidence            37999999999999884


No 82 
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=89.16  E-value=0.22  Score=32.75  Aligned_cols=21  Identities=19%  Similarity=0.450  Sum_probs=16.6

Q ss_pred             cccccCceeeeEEEeCC-Ceee
Q 048032           72 ELGQGGYGRVYKGKLSD-GRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~-g~~v   92 (93)
                      .||+|+||.||++...+ +..+
T Consensus        50 ~lG~G~fg~Vy~~~~~~~~~~~   71 (370)
T cd05621          50 VIGRGAFGEVQLVRHKSSQKVY   71 (370)
T ss_pred             EEEecCCeEEEEEEECCCCCEE
Confidence            69999999999998753 4433


No 83 
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=88.96  E-value=0.37  Score=30.00  Aligned_cols=17  Identities=29%  Similarity=0.597  Sum_probs=14.7

Q ss_pred             hccccccCceeeeEEEe
Q 048032           70 KDELGQGGYGRVYKGKL   86 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l   86 (93)
                      .+.||+|+||.||++..
T Consensus         9 ~~~lg~g~~g~v~~~~~   25 (284)
T cd05081           9 IQQLGKGNFGSVELCRY   25 (284)
T ss_pred             eeeccCCCCceEEEEEe
Confidence            34899999999999875


No 84 
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=88.95  E-value=0.29  Score=35.13  Aligned_cols=22  Identities=36%  Similarity=0.755  Sum_probs=16.4

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||.|+||.||-+.- .+.++||
T Consensus        33 EIGHGSFGAVYfArd~~n~evVA   55 (948)
T KOG0577|consen   33 EIGHGSFGAVYFARDVRNSEVVA   55 (948)
T ss_pred             HhcCCccceeEEeeccCccceee
Confidence            699999999998754 3444444


No 85 
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=88.85  E-value=0.34  Score=33.63  Aligned_cols=20  Identities=20%  Similarity=0.365  Sum_probs=16.6

Q ss_pred             ccccccCceeeeEEEeCCCe
Q 048032           71 DELGQGGYGRVYKGKLSDGR   90 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~   90 (93)
                      +.||+|+||.||+|.+++..
T Consensus       339 ~~iG~G~~g~Vy~~~~~~~~  358 (535)
T PRK09605        339 HLIGKGAEADIKKGEYLGRD  358 (535)
T ss_pred             ceeccCCcEEEEEEeecCcc
Confidence            37999999999999886543


No 86 
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=88.79  E-value=0.31  Score=30.88  Aligned_cols=18  Identities=33%  Similarity=0.894  Sum_probs=15.5

Q ss_pred             hccccccCceeeeEEEeC
Q 048032           70 KDELGQGGYGRVYKGKLS   87 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~   87 (93)
                      .+.||+|+||.||++...
T Consensus        12 ~~~lg~G~~g~V~~a~~~   29 (303)
T cd05088          12 QDVIGEGNFGQVLKARIK   29 (303)
T ss_pred             eeeecCCCCceEEEEEEc
Confidence            348999999999999874


No 87 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=88.61  E-value=0.37  Score=30.46  Aligned_cols=22  Identities=55%  Similarity=1.096  Sum_probs=17.3

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|+||.||++... +|..+
T Consensus        11 ~~lg~G~~g~V~~~~~~~~~~~~   33 (303)
T cd07869          11 EKLGEGSYATVYKGKSKVNGKLV   33 (303)
T ss_pred             eeEEecCCEEEEEEEECCCCCEE
Confidence            37999999999999874 45444


No 88 
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=88.58  E-value=0.3  Score=32.64  Aligned_cols=16  Identities=38%  Similarity=0.798  Sum_probs=14.2

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||+|..
T Consensus        43 ~~LG~G~fG~Vy~~~~   58 (400)
T cd05105          43 RILGSGAFGKVVEGTA   58 (400)
T ss_pred             heecCCCCceEEEEEE
Confidence            3799999999999875


No 89 
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=88.51  E-value=0.45  Score=29.72  Aligned_cols=22  Identities=36%  Similarity=0.511  Sum_probs=17.2

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|++|+||++... +|..+
T Consensus        11 ~~ig~g~~g~v~~~~~~~~~~~~   33 (284)
T cd06620          11 SDLGAGNGGSVSKVKHIPTGTVM   33 (284)
T ss_pred             HHcCCCCCeEEEEEEEcCCCcEE
Confidence            48999999999998764 45443


No 90 
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=88.51  E-value=0.18  Score=33.16  Aligned_cols=21  Identities=19%  Similarity=0.430  Sum_probs=16.6

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|+||.||++... ++..+
T Consensus        50 ~lg~G~~g~Vy~~~~~~~~~~~   71 (370)
T cd05596          50 VIGRGAFGEVQLVRHKSSKQVY   71 (370)
T ss_pred             EEeeCCCEEEEEEEECCCCCEE
Confidence            7999999999999874 34443


No 91 
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=88.42  E-value=0.42  Score=33.75  Aligned_cols=22  Identities=41%  Similarity=0.833  Sum_probs=19.0

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||+|||..+|.+.- ..|+.+|
T Consensus        25 ~LGkGgFA~cYe~~~~~tge~~A   47 (592)
T KOG0575|consen   25 FLGKGGFARCYEARDLDTGEVVA   47 (592)
T ss_pred             eeccCcceEEEEEEEcCCCcEEE
Confidence            799999999999976 7787765


No 92 
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=88.36  E-value=0.33  Score=30.39  Aligned_cols=20  Identities=50%  Similarity=0.991  Sum_probs=15.9

Q ss_pred             cccccCceeeeEEEeC-CCee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      .||+|++|.||+|... +|..
T Consensus        12 ~ig~g~~~~v~~~~~~~~~~~   32 (291)
T cd07870          12 KLGEGSYATVYKGISRINGQL   32 (291)
T ss_pred             EEEecCCEEEEEEEEcCCCcE
Confidence            7999999999999763 3443


No 93 
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=88.33  E-value=0.24  Score=31.91  Aligned_cols=31  Identities=32%  Similarity=0.564  Sum_probs=21.3

Q ss_pred             HHHHhcchhc--cccccCceeeeEEEeC-CCeee
Q 048032           62 VKKMTNSFKD--ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        62 l~~at~~f~~--~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +...+++|..  .||.|+||.||++.-. +|..+
T Consensus         5 ~~~~~~~y~~~~~ig~g~~g~v~~~~~~~~~~~v   38 (328)
T cd07856           5 VFEITNRYVDLQPVGMGAFGLVCSARDQLTGQNV   38 (328)
T ss_pred             eeccccceEEEEeecccCCeEEEEEEECCCCCEE
Confidence            3345555553  7999999999999753 45443


No 94 
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=88.17  E-value=0.42  Score=29.74  Aligned_cols=17  Identities=53%  Similarity=1.075  Sum_probs=14.8

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|+||.||+|...
T Consensus        11 ~~lg~G~~g~V~~~~~~   27 (283)
T cd05091          11 EELGEDRFGKVYKGHLF   27 (283)
T ss_pred             HHhCCCCCCeEEEEEEe
Confidence            47899999999999863


No 95 
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=88.11  E-value=0.37  Score=31.75  Aligned_cols=16  Identities=31%  Similarity=0.733  Sum_probs=13.9

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||++..
T Consensus        44 ~~LG~G~fg~V~~~~~   59 (374)
T cd05106          44 KTLGAGAFGKVVEATA   59 (374)
T ss_pred             heecCCCcccEEEEEE
Confidence            4799999999999863


No 96 
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=88.06  E-value=0.5  Score=30.41  Aligned_cols=21  Identities=38%  Similarity=0.509  Sum_probs=16.6

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|+||.||++... +|..+
T Consensus        12 ~lg~G~~g~V~~~~~~~~~~~~   33 (331)
T cd06649          12 ELGAGNGGVVTKVQHKPSGLIM   33 (331)
T ss_pred             eecCCCCEEEEEEEECCCCcEE
Confidence            7999999999999874 34433


No 97 
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=87.89  E-value=0.31  Score=36.59  Aligned_cols=17  Identities=47%  Similarity=0.987  Sum_probs=15.1

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      ..||+|.||.||+|.+.
T Consensus       698 ~~lG~G~FG~VY~g~~~  714 (1025)
T KOG1095|consen  698 RVLGKGAFGEVYEGTYS  714 (1025)
T ss_pred             eeeccccccceEEEEEe
Confidence            36999999999999984


No 98 
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms]
Probab=87.77  E-value=0.46  Score=32.94  Aligned_cols=22  Identities=50%  Similarity=0.869  Sum_probs=17.7

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .+|.|.||.||+|+- ..|..||
T Consensus        17 klGDGTfGsV~la~~~~~~~~VA   39 (538)
T KOG0661|consen   17 KLGDGTFGSVYLAKSKETGELVA   39 (538)
T ss_pred             HhcCCcceeEEEeeecCCCceee
Confidence            789999999999976 4565554


No 99 
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=87.68  E-value=0.49  Score=29.96  Aligned_cols=21  Identities=38%  Similarity=0.909  Sum_probs=17.2

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++... +|..+
T Consensus        14 ~ig~g~~~~v~~~~~~~~~~~v   35 (309)
T cd07845          14 RIGEGTYGIVYRARDTTSGEIV   35 (309)
T ss_pred             eeeecCCEEEEEEEECCCCcEE
Confidence            7999999999999874 45554


No 100
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=87.62  E-value=0.59  Score=29.55  Aligned_cols=21  Identities=33%  Similarity=0.669  Sum_probs=17.1

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++... +|..+
T Consensus        27 ~lg~g~~g~v~~~~~~~~~~~v   48 (292)
T cd06657          27 KIGEGSTGIVCIATVKSSGKLV   48 (292)
T ss_pred             HcCCCCCeEEEEEEEcCCCeEE
Confidence            7999999999999874 55544


No 101
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=87.58  E-value=0.53  Score=29.61  Aligned_cols=22  Identities=36%  Similarity=0.806  Sum_probs=18.0

Q ss_pred             ccccccCceeeeEEEeCC-Ceee
Q 048032           71 DELGQGGYGRVYKGKLSD-GRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~-g~~v   92 (93)
                      +.||+|++|.||++...+ +..+
T Consensus        21 ~~lg~g~~~~v~~~~~~~~~~~~   43 (296)
T cd06618          21 GEIGSGTCGQVYKMRFKKTGHVM   43 (296)
T ss_pred             eEeeccCCeEEEEEEECCCCeEE
Confidence            489999999999999864 5544


No 102
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=87.45  E-value=0.58  Score=29.06  Aligned_cols=22  Identities=36%  Similarity=0.809  Sum_probs=17.1

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|++|.||+|... ++..+
T Consensus        10 ~~l~~g~~~~vy~~~~~~~~~~v   32 (277)
T cd06642          10 ERIGKGSFGEVYKGIDNRTKEVV   32 (277)
T ss_pred             HHhcCCCCeeEEEEEEcCCCeEE
Confidence            37899999999999874 45444


No 103
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=87.42  E-value=0.4  Score=29.73  Aligned_cols=18  Identities=39%  Similarity=0.894  Sum_probs=15.4

Q ss_pred             ccccccCceeeeEEEeCC
Q 048032           71 DELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~   88 (93)
                      +.||+|++|.||+|...+
T Consensus        11 ~~lg~g~~~~v~~~~~~~   28 (280)
T cd05049          11 RELGEGAFGKVFLGECYH   28 (280)
T ss_pred             hhccccCCceEeeeeecc
Confidence            479999999999998743


No 104
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=87.16  E-value=0.59  Score=30.41  Aligned_cols=21  Identities=29%  Similarity=0.263  Sum_probs=16.5

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|+||.||++.-. .|..+
T Consensus        28 ~lg~G~~g~V~~~~~~~~~~~v   49 (359)
T cd07876          28 PIGSGAQGIVCAAFDTVLGINV   49 (359)
T ss_pred             EeecCCCEEEEEEEEcCCCcee
Confidence            7999999999999763 45444


No 105
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=87.03  E-value=0.59  Score=29.48  Aligned_cols=21  Identities=48%  Similarity=0.898  Sum_probs=16.5

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++... ++..+
T Consensus        13 ~lg~g~~g~vy~~~~~~~~~~v   34 (301)
T cd07873          13 KLGEGTYATVYKGRSKLTDNLV   34 (301)
T ss_pred             EeccCcCEEEEEEEEcCCCcEE
Confidence            7999999999999764 34443


No 106
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=86.97  E-value=0.47  Score=29.30  Aligned_cols=18  Identities=33%  Similarity=0.890  Sum_probs=15.6

Q ss_pred             hccccccCceeeeEEEeC
Q 048032           70 KDELGQGGYGRVYKGKLS   87 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~   87 (93)
                      .+.||+|+||.||+|...
T Consensus         9 ~~~lg~g~~g~vy~~~~~   26 (269)
T cd05065           9 EEVIGAGEFGEVCRGRLK   26 (269)
T ss_pred             EeEecCCCCCeEEEEEEe
Confidence            447999999999999874


No 107
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=86.89  E-value=0.61  Score=29.93  Aligned_cols=21  Identities=43%  Similarity=0.803  Sum_probs=16.7

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++... ++..+
T Consensus        16 ~ig~G~~g~vy~~~~~~~~~~v   37 (335)
T PTZ00024         16 HLGEGTYGKVEKAYDTLTGKIV   37 (335)
T ss_pred             cccCCCceeEEEEEECCCCCeE
Confidence            7999999999999864 45444


No 108
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=86.69  E-value=0.6  Score=29.18  Aligned_cols=22  Identities=55%  Similarity=1.067  Sum_probs=17.3

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|++|.||++... ++..+
T Consensus        11 ~~lg~g~~~~vy~~~~~~~~~~~   33 (291)
T cd07844          11 DKLGEGSYATVYKGRSKLTGQLV   33 (291)
T ss_pred             EEEeecCCeEEEEEEEcCCCcEE
Confidence            38999999999999875 44443


No 109
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=86.68  E-value=0.71  Score=29.83  Aligned_cols=20  Identities=40%  Similarity=0.601  Sum_probs=16.2

Q ss_pred             cccccCceeeeEEEeC-CCee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      .||+|+||.||++... +|..
T Consensus        12 ~lg~g~~g~V~~~~~~~~~~~   32 (333)
T cd06650          12 ELGAGNGGVVFKVSHKPSGLI   32 (333)
T ss_pred             cccCCCCEEEEEEEECCCCcE
Confidence            7999999999999875 3443


No 110
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=86.51  E-value=0.63  Score=30.14  Aligned_cols=21  Identities=33%  Similarity=0.574  Sum_probs=16.7

Q ss_pred             cccccCceeeeEEEe-CCCeee
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~v   92 (93)
                      .||+|++|.||++.. .+|..+
T Consensus        22 ~lg~G~~g~V~~~~~~~~~~~v   43 (343)
T cd07880          22 QVGSGAYGTVCSALDRRTGAKV   43 (343)
T ss_pred             EeeecCCeEEEEEEECCCCcEE
Confidence            799999999999975 355544


No 111
>PHA03209 serine/threonine kinase US3; Provisional
Probab=86.50  E-value=0.67  Score=30.26  Aligned_cols=17  Identities=29%  Similarity=0.472  Sum_probs=15.1

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      .||+|+||.||++...+
T Consensus        73 ~lg~G~~g~Vy~~~~~~   89 (357)
T PHA03209         73 TLTPGSEGRVFVATKPG   89 (357)
T ss_pred             EecCCCCeEEEEEEECC
Confidence            79999999999998753


No 112
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=86.47  E-value=0.52  Score=29.32  Aligned_cols=17  Identities=47%  Similarity=0.878  Sum_probs=15.0

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|+||.||+|...
T Consensus        13 ~~ig~g~~g~v~~~~~~   29 (279)
T cd05057          13 KVLGSGAFGTVYKGVWI   29 (279)
T ss_pred             ceecCCCCccEEEEEEe
Confidence            47999999999999874


No 113
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=86.44  E-value=0.58  Score=31.35  Aligned_cols=17  Identities=35%  Similarity=0.718  Sum_probs=14.8

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|+||.||++...
T Consensus        43 ~~lG~G~fG~Vy~~~~~   59 (401)
T cd05107          43 RTLGSGAFGRVVEATAH   59 (401)
T ss_pred             hhccCCCceeEEEEEEc
Confidence            37999999999999863


No 114
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=86.32  E-value=0.67  Score=30.36  Aligned_cols=20  Identities=35%  Similarity=0.710  Sum_probs=16.4

Q ss_pred             ccccccCceeeeEEEeCC-Ce
Q 048032           71 DELGQGGYGRVYKGKLSD-GR   90 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~-g~   90 (93)
                      +.||+|.||+||.+...+ |.
T Consensus        23 ~~lG~Gs~G~V~l~~~~~~g~   43 (313)
T KOG0198|consen   23 KLLGRGSFGSVYLATNKKTGE   43 (313)
T ss_pred             ccccCccceEEEEEEecCCCc
Confidence            379999999999998753 44


No 115
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=86.18  E-value=0.69  Score=28.48  Aligned_cols=22  Identities=41%  Similarity=0.836  Sum_probs=16.8

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|++|.||++... ++..+
T Consensus        15 ~~lg~g~~~~v~~~~~~~~~~~~   37 (267)
T cd06645          15 QRIGSGTYGDVYKARNVNTGELA   37 (267)
T ss_pred             HHhCCCCCeEEEEEEEcCCCcEE
Confidence            37999999999999763 44443


No 116
>PF15102 TMEM154:  TMEM154 protein family
Probab=86.04  E-value=0.92  Score=26.45  Aligned_cols=6  Identities=0%  Similarity=0.185  Sum_probs=2.7

Q ss_pred             echHHH
Q 048032           57 YSFPNV   62 (93)
Q Consensus        57 ~~~~~l   62 (93)
                      +.++||
T Consensus       125 iEmeel  130 (146)
T PF15102_consen  125 IEMEEL  130 (146)
T ss_pred             hhHHHH
Confidence            344444


No 117
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=86.02  E-value=0.58  Score=30.12  Aligned_cols=21  Identities=33%  Similarity=0.575  Sum_probs=16.8

Q ss_pred             cccccCceeeeEEEe-CCCeee
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~v   92 (93)
                      .||+|++|.||+|.. .+|..+
T Consensus        12 ~lg~G~~g~vy~~~~~~~~~~v   33 (336)
T cd07849          12 YIGEGAYGMVCSATHKPTGVKV   33 (336)
T ss_pred             EEEecCCeEEEEEEEcCCCCeE
Confidence            799999999999975 355544


No 118
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]
Probab=85.94  E-value=0.69  Score=31.07  Aligned_cols=23  Identities=43%  Similarity=0.733  Sum_probs=18.3

Q ss_pred             ccccccCceeeeEEEeCC-CeeeC
Q 048032           71 DELGQGGYGRVYKGKLSD-GRLVA   93 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~-g~~va   93 (93)
                      +.||+|.||.||++.-+. |..+|
T Consensus        41 ~~lG~G~Fg~v~~~~~~~tg~~~A   64 (382)
T KOG0032|consen   41 RELGRGQFGVVYLCREKSTGKEVA   64 (382)
T ss_pred             hhhCCCCceEEEEEEecCCCceeE
Confidence            479999999999998865 65543


No 119
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=85.92  E-value=0.81  Score=28.70  Aligned_cols=20  Identities=55%  Similarity=1.074  Sum_probs=16.3

Q ss_pred             cccccCceeeeEEEeCC-Cee
Q 048032           72 ELGQGGYGRVYKGKLSD-GRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~-g~~   91 (93)
                      .||.|++|.||++...+ +..
T Consensus        19 ~lg~g~~g~vy~~~~~~~~~~   39 (292)
T cd06644          19 ELGDGAFGKVYKAKNKETGAL   39 (292)
T ss_pred             eecCCCCeEEEEEEECCCCce
Confidence            79999999999998753 443


No 120
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=85.92  E-value=0.66  Score=28.73  Aligned_cols=17  Identities=29%  Similarity=0.665  Sum_probs=15.1

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|+||.||++.+.
T Consensus        10 ~~ig~g~~~~v~~~~~~   26 (284)
T cd05038          10 KQLGEGHFGKVELCRYD   26 (284)
T ss_pred             eeeccCCCeeEEEeeec
Confidence            47999999999999874


No 121
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=85.91  E-value=0.59  Score=30.24  Aligned_cols=21  Identities=38%  Similarity=0.657  Sum_probs=16.7

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++... ++..+
T Consensus        22 ~ig~g~~g~vy~~~~~~~~~~~   43 (343)
T cd07851          22 PVGSGAYGQVCSAFDTKTGRKV   43 (343)
T ss_pred             EeccCCceEEEEEEECCCCcEE
Confidence            7999999999999885 34433


No 122
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]
Probab=85.62  E-value=0.57  Score=30.31  Aligned_cols=16  Identities=38%  Similarity=0.804  Sum_probs=14.3

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|+||.||.+.-.
T Consensus        25 ~iG~G~fG~V~~v~~~   40 (322)
T KOG1164|consen   25 KIGEGGFGAVYLVSDK   40 (322)
T ss_pred             eccccCCceEEEEEec
Confidence            7999999999998753


No 123
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=85.60  E-value=0.81  Score=29.42  Aligned_cols=22  Identities=36%  Similarity=0.647  Sum_probs=17.2

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|++|.||+|... +|..+
T Consensus        13 ~~lg~g~~~~v~~~~~~~~~~~~   35 (337)
T cd07852          13 QKLGKGAYGIVWKAIDRRTKEVV   35 (337)
T ss_pred             HhhcCCCCeeEEEEEEcCCCeEE
Confidence            37999999999999875 34443


No 124
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]
Probab=85.53  E-value=0.55  Score=30.18  Aligned_cols=22  Identities=36%  Similarity=0.794  Sum_probs=18.5

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||+|+||-.|.|.- .+|+.||
T Consensus        22 kiGsGSFGdIy~~~~i~~ge~VA   44 (341)
T KOG1163|consen   22 KIGSGSFGDIYLGISITSGEEVA   44 (341)
T ss_pred             eecCCchhheeeeeeccCCceEE
Confidence            699999999999854 6787775


No 125
>PHA03210 serine/threonine kinase US3; Provisional
Probab=85.40  E-value=0.59  Score=32.21  Aligned_cols=15  Identities=27%  Similarity=0.758  Sum_probs=13.6

Q ss_pred             cccccCceeeeEEEe
Q 048032           72 ELGQGGYGRVYKGKL   86 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l   86 (93)
                      .||+|+||.||++.+
T Consensus       155 ~LG~G~fG~Vyl~~~  169 (501)
T PHA03210        155 DLPAGAFGKIFICAL  169 (501)
T ss_pred             EecCCCCcceEEEEE
Confidence            699999999998865


No 126
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=85.34  E-value=0.64  Score=30.24  Aligned_cols=17  Identities=35%  Similarity=0.685  Sum_probs=14.9

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|+||.||++...
T Consensus        36 ~~ig~G~~g~Vy~a~~~   52 (340)
T PTZ00426         36 RTLGTGSFGRVILATYK   52 (340)
T ss_pred             EEEeecCCeEEEEEEEE
Confidence            37999999999999864


No 127
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=85.32  E-value=0.68  Score=28.78  Aligned_cols=17  Identities=59%  Similarity=1.327  Sum_probs=14.9

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|++|.||+|...
T Consensus        11 ~~lg~G~~g~Vy~~~~~   27 (283)
T cd05048          11 EELGEGAFGKVYKGELT   27 (283)
T ss_pred             hcccCccCCcEEEEEEe
Confidence            47999999999999874


No 128
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=85.11  E-value=0.78  Score=28.98  Aligned_cols=21  Identities=38%  Similarity=0.642  Sum_probs=16.9

Q ss_pred             cccccCceeeeEEEe-CCCeee
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~v   92 (93)
                      .||+|++|.||++.- .++..+
T Consensus        26 ~lg~g~~g~v~~~~~~~~~~~v   47 (297)
T cd06656          26 KIGQGASGTVYTAIDIATGQEV   47 (297)
T ss_pred             eeccCCCeEEEEEEECCCCCEE
Confidence            699999999999985 455554


No 129
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=85.11  E-value=0.9  Score=28.77  Aligned_cols=21  Identities=33%  Similarity=0.705  Sum_probs=17.0

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++... +|..+
T Consensus        22 ~lg~g~~g~vy~~~~~~~~~~v   43 (307)
T cd06607          22 EIGHGSFGAVYFARDVRTNEVV   43 (307)
T ss_pred             eecCCCCeEEEEEEEcCCCcEE
Confidence            7999999999999874 45544


No 130
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=84.95  E-value=0.88  Score=27.87  Aligned_cols=18  Identities=28%  Similarity=0.685  Sum_probs=15.5

Q ss_pred             ccccccCceeeeEEEeCC
Q 048032           71 DELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~   88 (93)
                      +.||+|++|.||++..++
T Consensus        12 ~~lg~g~~~~v~~~~~~~   29 (256)
T cd05082          12 QTIGKGEFGDVMLGDYRG   29 (256)
T ss_pred             eeecccCCCeEEEEEEcC
Confidence            479999999999998753


No 131
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=84.91  E-value=0.77  Score=28.30  Aligned_cols=17  Identities=47%  Similarity=0.946  Sum_probs=15.0

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|++|.||++...
T Consensus        12 ~~ig~g~~~~v~~~~~~   28 (263)
T cd05052          12 HKLGGGQYGEVYEGVWK   28 (263)
T ss_pred             eecCCcccceEEEEEEe
Confidence            47999999999999874


No 132
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=84.86  E-value=0.7  Score=29.25  Aligned_cols=15  Identities=53%  Similarity=1.015  Sum_probs=14.0

Q ss_pred             cccccCceeeeEEEe
Q 048032           72 ELGQGGYGRVYKGKL   86 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l   86 (93)
                      .||+|++|.||++..
T Consensus        14 ~lg~G~~g~vy~~~~   28 (303)
T cd05110          14 VLGSGAFGTVYKGIW   28 (303)
T ss_pred             ccccCCCccEEEEEE
Confidence            799999999999976


No 133
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=84.80  E-value=0.61  Score=29.01  Aligned_cols=17  Identities=41%  Similarity=0.937  Sum_probs=15.2

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      .||+|++|.||++...+
T Consensus        13 ~lg~g~~g~vy~~~~~~   29 (277)
T cd05036          13 ALGHGAFGEVYEGLYRG   29 (277)
T ss_pred             ECCCCCCCcEEEEEEec
Confidence            79999999999998854


No 134
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=84.61  E-value=0.96  Score=29.27  Aligned_cols=22  Identities=32%  Similarity=0.362  Sum_probs=17.0

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||.|++|.||++... +|..+
T Consensus        11 ~~Lg~g~~g~vy~~~~~~~~~~v   33 (342)
T cd07854          11 RPLGCGSNGLVFSAVDSDCDKRV   33 (342)
T ss_pred             EEecCCCCEEEEEEEECCCCcEE
Confidence            37999999999999763 45443


No 135
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=84.49  E-value=0.91  Score=28.45  Aligned_cols=21  Identities=33%  Similarity=0.768  Sum_probs=16.9

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||.|++|.||++..+ ++..+
T Consensus        12 ~lg~g~~~~v~~~~~~~~~~~~   33 (293)
T cd07843          12 RIEEGTYGVVYRARDKKTGEIV   33 (293)
T ss_pred             hhcCCCCeEEEEEEECCCCcEE
Confidence            7999999999999885 34433


No 136
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=84.41  E-value=0.8  Score=29.25  Aligned_cols=17  Identities=35%  Similarity=0.769  Sum_probs=14.8

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      .+|+|.||.||.|.-..
T Consensus        29 ~LgkgkFG~vYlarekk   45 (281)
T KOG0580|consen   29 PLGKGKFGNVYLAREKK   45 (281)
T ss_pred             cccCCccccEeEeeecc
Confidence            79999999999997743


No 137
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]
Probab=84.36  E-value=0.43  Score=31.03  Aligned_cols=20  Identities=40%  Similarity=0.737  Sum_probs=15.2

Q ss_pred             cccccCceeeeEEEe-CCCee
Q 048032           72 ELGQGGYGRVYKGKL-SDGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~   91 (93)
                      .||.|.||+|+|=.. +.|..
T Consensus        71 ~iG~G~fG~V~KM~hk~sg~~   91 (361)
T KOG1006|consen   71 EIGNGAFGTVNKMLHKPSGKL   91 (361)
T ss_pred             HhcCCcchhhhhhhcCccCcE
Confidence            799999999998544 34443


No 138
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=84.31  E-value=0.8  Score=28.32  Aligned_cols=16  Identities=38%  Similarity=0.810  Sum_probs=14.3

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|+||.||++...
T Consensus        12 ~lg~g~~g~v~~~~~~   27 (275)
T cd05046          12 TLGRGEFGEVFLAKAK   27 (275)
T ss_pred             eecccceeEEEEEEec
Confidence            6999999999999863


No 139
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=84.28  E-value=0.43  Score=34.80  Aligned_cols=20  Identities=40%  Similarity=0.923  Sum_probs=16.6

Q ss_pred             hhccccccCceeeeEEEeCC
Q 048032           69 FKDELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        69 f~~~iG~G~~g~VYk~~l~~   88 (93)
                      |.+.||+|.||.||+|..++
T Consensus       490 ~~~eLGegaFGkVf~a~~~~  509 (774)
T KOG1026|consen  490 FKEELGEGAFGKVFLAEAYG  509 (774)
T ss_pred             ehhhhcCchhhhhhhhhccC
Confidence            34579999999999998854


No 140
>PHA03212 serine/threonine kinase US3; Provisional
Probab=84.21  E-value=0.99  Score=30.07  Aligned_cols=21  Identities=14%  Similarity=0.096  Sum_probs=16.2

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|+||.||++.-. .+..+
T Consensus        99 ~lg~G~~g~V~~~~d~~~~~~v  120 (391)
T PHA03212         99 TFTPGAEGFAFACIDNKTCEHV  120 (391)
T ss_pred             EEcCCCCeEEEEEEECCCCCEE
Confidence            6999999999998763 34444


No 141
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms]
Probab=84.09  E-value=0.12  Score=34.11  Aligned_cols=22  Identities=41%  Similarity=0.750  Sum_probs=17.7

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .+|+|++|+|||+.- ..|+.+|
T Consensus        40 KLGEGSYGSV~KAIH~EsG~v~A   62 (502)
T KOG0574|consen   40 KLGEGSYGSVHKAIHRESGHVLA   62 (502)
T ss_pred             HhcCCcchHHHHHHHhccCcEEE
Confidence            799999999999876 3566654


No 142
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=84.01  E-value=0.81  Score=28.68  Aligned_cols=16  Identities=56%  Similarity=1.086  Sum_probs=14.1

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||+|..
T Consensus        12 ~~lg~G~~g~Vy~~~~   27 (288)
T cd05061          12 RELGQGSFGMVYEGNA   27 (288)
T ss_pred             eeecCCCCcEEEEEEE
Confidence            3899999999999865


No 143
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=83.95  E-value=1.2  Score=27.73  Aligned_cols=18  Identities=44%  Similarity=0.979  Sum_probs=15.5

Q ss_pred             ccccccCceeeeEEEeCC
Q 048032           71 DELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~   88 (93)
                      +.||+|++|.||++....
T Consensus        11 ~~lg~g~~g~v~~~~~~~   28 (282)
T cd06643          11 GELGDGAFGKVYKAQNKE   28 (282)
T ss_pred             hhcccCCCeEEEEEEECC
Confidence            379999999999998753


No 144
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=83.91  E-value=1.1  Score=28.20  Aligned_cols=21  Identities=33%  Similarity=0.803  Sum_probs=16.8

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++... ++..+
T Consensus        19 ~lg~g~~~~v~~~~~~~~~~~~   40 (310)
T cd07865          19 KIGQGTFGEVFKARHKKTKQIV   40 (310)
T ss_pred             EeecCCCEEEEEEEECCCCcEE
Confidence            7999999999999874 45444


No 145
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=83.83  E-value=0.82  Score=28.56  Aligned_cols=16  Identities=38%  Similarity=1.055  Sum_probs=14.2

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|+||.||++..+
T Consensus        12 ~lg~g~~g~v~~~~~~   27 (288)
T cd05050          12 DIGQGAFGRVFQARAP   27 (288)
T ss_pred             cccccccccEEEEEEc
Confidence            7999999999999763


No 146
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=83.73  E-value=0.86  Score=28.52  Aligned_cols=18  Identities=28%  Similarity=0.586  Sum_probs=15.4

Q ss_pred             ccccccCceeeeEEEeCC
Q 048032           71 DELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~   88 (93)
                      +.||+|+||.||++..++
T Consensus        11 ~~lg~G~~g~v~~~~~~~   28 (296)
T cd05051          11 EKLGEGQFGEVHLCEADG   28 (296)
T ss_pred             ccccCCCCccEEEEEecc
Confidence            489999999999988753


No 147
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=83.65  E-value=1.1  Score=28.54  Aligned_cols=21  Identities=33%  Similarity=0.705  Sum_probs=16.6

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|+||.||++... +|..+
T Consensus        32 ~lg~G~~~~v~~~~~~~~~~~v   53 (317)
T cd06635          32 EIGHGSFGAVYFARDVRTNEVV   53 (317)
T ss_pred             eeccCCCeEEEEEEEcCCCcEE
Confidence            7999999999999874 44443


No 148
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=83.22  E-value=0.95  Score=27.99  Aligned_cols=17  Identities=53%  Similarity=0.968  Sum_probs=14.9

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      ..||+|+||.||++...
T Consensus        12 ~~lg~g~~g~v~~~~~~   28 (277)
T cd05032          12 RELGQGSFGMVYEGLAK   28 (277)
T ss_pred             eEecCCCCceEEEEEEe
Confidence            37999999999999874


No 149
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=83.18  E-value=1.1  Score=28.06  Aligned_cols=16  Identities=31%  Similarity=0.700  Sum_probs=14.0

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      ..||+|+||.||.+..
T Consensus        10 ~~lg~g~~g~v~~~~~   25 (284)
T cd05079          10 RDLGEGHFGKVELCRY   25 (284)
T ss_pred             eecCCCCceeEEEEEE
Confidence            3799999999999875


No 150
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=83.11  E-value=0.77  Score=28.51  Aligned_cols=15  Identities=60%  Similarity=1.101  Sum_probs=13.7

Q ss_pred             cccccCceeeeEEEe
Q 048032           72 ELGQGGYGRVYKGKL   86 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l   86 (93)
                      .||+|++|.||+|..
T Consensus        13 ~ig~G~~g~v~~~~~   27 (277)
T cd05062          13 ELGQGSFGMVYEGIA   27 (277)
T ss_pred             eeccccCCeEEEEEe
Confidence            799999999999875


No 151
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only]
Probab=83.05  E-value=0.98  Score=31.80  Aligned_cols=26  Identities=23%  Similarity=0.489  Sum_probs=21.8

Q ss_pred             chhc-cccccCceeeeEEEeCCCeeeC
Q 048032           68 SFKD-ELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        68 ~f~~-~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      .|++ .|+.-+.|.||++.|++|+.||
T Consensus       163 ~f~~~piaaASlaQVhrA~L~~G~~Va  189 (538)
T KOG1235|consen  163 EFDEEPIAAASLAQVHRARLKNGEDVA  189 (538)
T ss_pred             hcCcchhhhcchhheEEEEecCCCEEE
Confidence            3454 6999999999999999998764


No 152
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=82.95  E-value=1  Score=32.50  Aligned_cols=16  Identities=38%  Similarity=0.806  Sum_probs=14.9

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      ++|+|.||.|+.+.+.
T Consensus       375 vLGkGsFGkV~lae~k  390 (694)
T KOG0694|consen  375 VLGRGSFGKVLLAELK  390 (694)
T ss_pred             EeccCcCceEEEEEEc
Confidence            7999999999999884


No 153
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=82.92  E-value=1  Score=27.80  Aligned_cols=19  Identities=32%  Similarity=0.709  Sum_probs=15.8

Q ss_pred             hccccccCceeeeEEEeCC
Q 048032           70 KDELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~~   88 (93)
                      .+.||+|++|.||+|...+
T Consensus        11 ~~~lg~g~~g~v~~~~~~~   29 (270)
T cd05056          11 GRCIGEGQFGDVYQGVYMS   29 (270)
T ss_pred             eeeeCCccceeEEEEEEec
Confidence            3489999999999998643


No 154
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=82.90  E-value=1.1  Score=29.08  Aligned_cols=15  Identities=27%  Similarity=0.348  Sum_probs=13.6

Q ss_pred             cccccCceeeeEEEe
Q 048032           72 ELGQGGYGRVYKGKL   86 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l   86 (93)
                      .||+|+||.||++.-
T Consensus        24 ~lg~G~~g~V~~~~~   38 (355)
T cd07874          24 PIGSGAQGIVCAAYD   38 (355)
T ss_pred             EeeecCCEEEEEEEe
Confidence            799999999999865


No 155
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=82.86  E-value=1.4  Score=27.39  Aligned_cols=22  Identities=32%  Similarity=0.786  Sum_probs=17.2

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||.|++|.||+|... ++..+
T Consensus        10 ~~lg~g~~~~vy~~~~~~~~~~v   32 (277)
T cd06640          10 ERIGKGSFGEVFKGIDNRTQQVV   32 (277)
T ss_pred             hhcccCCCeEEEEEEEccCCEEE
Confidence            37899999999999874 45544


No 156
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms]
Probab=82.76  E-value=0.98  Score=31.22  Aligned_cols=22  Identities=41%  Similarity=0.739  Sum_probs=17.7

Q ss_pred             ccccccCceeeeEEEeCCCeee
Q 048032           71 DELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      ..||+|-||.|+.|.+++...|
T Consensus       212 ~~LG~G~FG~V~~g~~~~~~~v  233 (468)
T KOG0197|consen  212 RELGSGQFGEVWLGKWNGSTKV  233 (468)
T ss_pred             HHhcCCccceEEEEEEcCCCcc
Confidence            3699999999999999654344


No 157
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=82.60  E-value=1.3  Score=28.03  Aligned_cols=21  Identities=33%  Similarity=0.580  Sum_probs=16.6

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|+||.||++... ++..+
T Consensus        28 ~ig~g~~g~v~~~~~~~~~~~v   49 (297)
T cd06659          28 KIGEGSTGIVCIAREKHSGRQV   49 (297)
T ss_pred             hcCCCCceeEEEEEEcCCCCEE
Confidence            6999999999999763 45443


No 158
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=82.54  E-value=1.3  Score=28.21  Aligned_cols=20  Identities=35%  Similarity=0.710  Sum_probs=16.0

Q ss_pred             cccccCceeeeEEEeC-CCee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      .||+|++|.||+|... +|..
T Consensus        28 ~lg~g~~g~v~~~~~~~~~~~   48 (313)
T cd06633          28 EIGHGSFGAVYFATNSHTNEV   48 (313)
T ss_pred             eeccCCCeEEEEEEECCCCcE
Confidence            6999999999999874 3443


No 159
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=82.47  E-value=1.2  Score=32.00  Aligned_cols=22  Identities=27%  Similarity=0.770  Sum_probs=17.6

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|+||.||++... ++..|
T Consensus        10 ~~LG~G~fg~Vy~a~~~~~~~~v   32 (669)
T cd05610          10 KPISRGAFGKVYLGRKKNNSKLY   32 (669)
T ss_pred             EEEecCCCeEEEEEEECCCCcEE
Confidence            47999999999999875 45444


No 160
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=82.18  E-value=1.4  Score=26.84  Aligned_cols=18  Identities=44%  Similarity=0.946  Sum_probs=15.7

Q ss_pred             ccccccCceeeeEEEeCC
Q 048032           71 DELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~   88 (93)
                      +.||+|++|.||++...+
T Consensus         9 ~~i~~g~~~~v~~~~~~~   26 (256)
T cd06612           9 EKLGEGSYGSVYKAIHKE   26 (256)
T ss_pred             hhhcCCCCeEEEEEEEcC
Confidence            378999999999998864


No 161
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=82.14  E-value=0.85  Score=28.69  Aligned_cols=17  Identities=29%  Similarity=0.612  Sum_probs=14.3

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||+|+||.||++...
T Consensus        11 ~~lg~G~~g~v~~~~~~   27 (295)
T cd05097          11 EKLGEGQFGEVHLCEAE   27 (295)
T ss_pred             hccCCCCCceEEecccc
Confidence            47999999999987653


No 162
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=82.08  E-value=1.3  Score=28.87  Aligned_cols=15  Identities=27%  Similarity=0.348  Sum_probs=13.7

Q ss_pred             cccccCceeeeEEEe
Q 048032           72 ELGQGGYGRVYKGKL   86 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l   86 (93)
                      .||+|+||.||++.-
T Consensus        31 ~lg~G~~g~V~~~~~   45 (364)
T cd07875          31 PIGSGAQGIVCAAYD   45 (364)
T ss_pred             EeecCCCeEEEEEEE
Confidence            799999999999875


No 163
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=82.01  E-value=1.4  Score=27.71  Aligned_cols=20  Identities=45%  Similarity=0.973  Sum_probs=16.1

Q ss_pred             cccccCceeeeEEEeC-CCee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      .||+|++|.||++... ++..
T Consensus        15 ~lg~g~~~~v~~~~~~~~~~~   35 (311)
T cd07866          15 KLGEGTFGEVYKARQIKTGRV   35 (311)
T ss_pred             EeccCCCEEEEEEEECCCCcE
Confidence            7999999999999864 3443


No 164
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=81.88  E-value=1.1  Score=27.91  Aligned_cols=17  Identities=41%  Similarity=0.823  Sum_probs=14.5

Q ss_pred             hccccccCceeeeEEEe
Q 048032           70 KDELGQGGYGRVYKGKL   86 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l   86 (93)
                      .+.||+|+||.||++..
T Consensus        10 ~~~lg~g~~g~v~~~~~   26 (280)
T cd05092          10 KWELGEGAFGKVFLAEC   26 (280)
T ss_pred             ccccCCccCCeEEEeEE
Confidence            34899999999999864


No 165
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=81.81  E-value=1.3  Score=27.93  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=16.3

Q ss_pred             cccccCceeeeEEEe-CCCeee
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~v   92 (93)
                      .||+|++|.||++.. .++..+
T Consensus        27 ~lg~g~~~~v~~~~~~~~~~~v   48 (296)
T cd06654          27 KIGQGASGTVYTAMDVATGQEV   48 (296)
T ss_pred             EecCCCCeEEEEEEECCCCcEE
Confidence            699999999999975 344443


No 166
>PHA03211 serine/threonine kinase US3; Provisional
Probab=81.68  E-value=1.4  Score=30.29  Aligned_cols=17  Identities=29%  Similarity=0.487  Sum_probs=15.0

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      .||+|+||.||++..++
T Consensus       176 ~Lg~G~~G~Vy~a~~~~  192 (461)
T PHA03211        176 ALTPGSEGCVFESSHPD  192 (461)
T ss_pred             EEccCCCeEEEEEEECC
Confidence            69999999999998854


No 167
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms]
Probab=81.47  E-value=0.92  Score=30.24  Aligned_cols=16  Identities=25%  Similarity=0.787  Sum_probs=14.0

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      +||+|+||.||.+.-.
T Consensus        32 viGkG~fGkV~~Vrk~   47 (357)
T KOG0598|consen   32 VIGKGSFGKVFQVRKK   47 (357)
T ss_pred             eeeccCCceEEEEEEc
Confidence            7999999999988654


No 168
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=81.17  E-value=1.5  Score=28.30  Aligned_cols=21  Identities=38%  Similarity=0.596  Sum_probs=16.3

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++.-. +|..+
T Consensus        12 ~lg~G~~~~vy~~~~~~~~~~v   33 (337)
T cd07858          12 PIGRGAYGIVCSAKNSETNEKV   33 (337)
T ss_pred             EeccCCCeEEEEEEecCCCCeE
Confidence            7999999999998763 44443


No 169
>PF09919 DUF2149:  Uncharacterized conserved protein (DUF2149);  InterPro: IPR018676  This family of conserved hypothetical proteins has no known function. 
Probab=81.11  E-value=1.5  Score=23.61  Aligned_cols=17  Identities=47%  Similarity=1.069  Sum_probs=13.4

Q ss_pred             ccc-CceeeeEEEeCCCeee
Q 048032           74 GQG-GYGRVYKGKLSDGRLV   92 (93)
Q Consensus        74 G~G-~~g~VYk~~l~~g~~v   92 (93)
                      |+| ..|++||  +++|..+
T Consensus        71 G~G~~~G~aYr--l~~Gk~I   88 (92)
T PF09919_consen   71 GSGERLGTAYR--LKDGKLI   88 (92)
T ss_pred             CCCeECeEEEE--cCCceEE
Confidence            555 7899999  8888864


No 170
>PTZ00370 STEVOR; Provisional
Probab=80.24  E-value=0.84  Score=29.55  Aligned_cols=9  Identities=22%  Similarity=0.707  Sum_probs=3.6

Q ss_pred             Hhhheeeec
Q 048032           13 AIICIFRKK   21 (93)
Q Consensus        13 ~~~~~~~~~   21 (93)
                      +.+|+++|+
T Consensus       274 lYiwlyrrR  282 (296)
T PTZ00370        274 LYIWLYRRR  282 (296)
T ss_pred             HHHHHHHhh
Confidence            333444333


No 171
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=80.13  E-value=1.6  Score=27.50  Aligned_cols=21  Identities=33%  Similarity=0.597  Sum_probs=16.2

Q ss_pred             ccccccCceeeeEEEeC-CCee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      +.||+|++|.||++... ++..
T Consensus        25 ~~lg~g~~g~v~~~~~~~~~~~   46 (293)
T cd06647          25 EKIGQGASGTVYTAIDVATGQE   46 (293)
T ss_pred             eEecCCCCeEEEEEEEcCCCCE
Confidence            37999999999999753 4443


No 172
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only]
Probab=80.02  E-value=1.4  Score=31.40  Aligned_cols=22  Identities=41%  Similarity=0.697  Sum_probs=17.3

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||+|.||.|-|+.- ..++.||
T Consensus       193 ~LGkGtFGQVvk~~d~~T~e~VA  215 (586)
T KOG0667|consen  193 VLGKGSFGQVVKAYDHKTGEIVA  215 (586)
T ss_pred             EecccccceeEEEEecCCCcEEE
Confidence            699999999999865 3466665


No 173
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms]
Probab=80.00  E-value=1.1  Score=32.92  Aligned_cols=22  Identities=32%  Similarity=0.684  Sum_probs=17.8

Q ss_pred             hccccccCceeeeEEEe--CCCee
Q 048032           70 KDELGQGGYGRVYKGKL--SDGRL   91 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l--~~g~~   91 (93)
                      -|+||+|.||.|.+|.+  ++|..
T Consensus       115 ~e~LG~GsFgvV~rg~Wt~psgk~  138 (1039)
T KOG0199|consen  115 YELLGEGSFGVVKRGTWTQPSGKH  138 (1039)
T ss_pred             HHHhcCcceeeEeeccccCCCCcE
Confidence            34799999999999988  45654


No 174
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=79.99  E-value=1.2  Score=27.18  Aligned_cols=18  Identities=28%  Similarity=0.783  Sum_probs=15.1

Q ss_pred             ccccccCceeeeEEEeCC
Q 048032           71 DELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~~   88 (93)
                      +.||+|+||.||++...+
T Consensus        12 ~~lg~g~~g~v~~~~~~~   29 (254)
T cd05083          12 EIIGEGEFGAVLQGEYTG   29 (254)
T ss_pred             eeeccCCCCceEecccCC
Confidence            489999999999987643


No 175
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=79.84  E-value=1.4  Score=27.51  Aligned_cols=20  Identities=35%  Similarity=0.697  Sum_probs=16.4

Q ss_pred             cccccCceeeeEEEeC-CCee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      .||+|++|.||++..+ ++..
T Consensus        26 ~l~~g~~~~v~~~~~~~~~~~   46 (286)
T cd06614          26 KIGEGASGEVYKATDRATGKE   46 (286)
T ss_pred             hccCCCCeEEEEEEEccCCcE
Confidence            7999999999999886 3443


No 176
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=79.75  E-value=1.3  Score=28.10  Aligned_cols=16  Identities=31%  Similarity=0.657  Sum_probs=13.9

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||++..
T Consensus        24 ~~lg~G~~g~V~~~~~   39 (307)
T cd05098          24 KPLGEGCFGQVVMAEA   39 (307)
T ss_pred             eeeccCCCeeEEEeEE
Confidence            3799999999999864


No 177
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms]
Probab=79.49  E-value=1.1  Score=32.68  Aligned_cols=17  Identities=47%  Similarity=0.931  Sum_probs=15.0

Q ss_pred             hccccccCceeeeEEEe
Q 048032           70 KDELGQGGYGRVYKGKL   86 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l   86 (93)
                      ...||.|-||.||+|+.
T Consensus       394 ~r~iG~GqFGdVy~gvY  410 (974)
T KOG4257|consen  394 KRLIGEGQFGDVYKGVY  410 (974)
T ss_pred             HHhhcCCcccceeeeEe
Confidence            34799999999999977


No 178
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=79.41  E-value=2  Score=27.10  Aligned_cols=21  Identities=29%  Similarity=0.499  Sum_probs=16.3

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++... ++..+
T Consensus        29 ~lg~g~~g~v~~~~~~~~~~~v   50 (292)
T cd06658          29 KIGEGSTGIVCIATEKHTGKQV   50 (292)
T ss_pred             cccCCCCeEEEEEEECCCCCEE
Confidence            6899999999999764 34433


No 179
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=79.24  E-value=1.9  Score=26.77  Aligned_cols=22  Identities=41%  Similarity=0.875  Sum_probs=17.1

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||.|++|.||++... ++..+
T Consensus        11 ~~l~~g~~~~v~~~~~~~~~~~~   33 (280)
T cd06611          11 GELGDGAFGKVYKAQHKETGLFA   33 (280)
T ss_pred             HHhcCCCCceEEEEEEcCCCcEE
Confidence            37899999999999874 34443


No 180
>PTZ00370 STEVOR; Provisional
Probab=79.11  E-value=0.77  Score=29.72  Aligned_cols=26  Identities=19%  Similarity=0.176  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHhhheeeeccCCcchh
Q 048032            3 AGMMGIIITCAIICIFRKKNNSSILW   28 (93)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~   28 (93)
                      +++++++.+++++++.|-.+++++.|
T Consensus       261 alvllil~vvliilYiwlyrrRK~sw  286 (296)
T PTZ00370        261 ALVLLILAVVLIILYIWLYRRRKNSW  286 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhcchh
Confidence            33444445566667777667765544


No 181
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=79.08  E-value=0.7  Score=30.10  Aligned_cols=8  Identities=38%  Similarity=0.488  Sum_probs=3.1

Q ss_pred             HHhhheee
Q 048032           12 CAIICIFR   19 (93)
Q Consensus        12 ~~~~~~~~   19 (93)
                      +++++++|
T Consensus       273 vIIYLILR  280 (299)
T PF02009_consen  273 VIIYLILR  280 (299)
T ss_pred             HHHHHHHH
Confidence            33333343


No 182
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=78.79  E-value=1.9  Score=27.68  Aligned_cols=22  Identities=32%  Similarity=0.647  Sum_probs=17.1

Q ss_pred             ccccccCceeeeEEEeC-CCeee
Q 048032           71 DELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      +.||+|++|.||++... +|..+
T Consensus        11 ~~lg~g~~g~v~~~~~~~~~~~v   33 (334)
T cd07855          11 ENIGSGAYGVVCSAIDTRSGKKV   33 (334)
T ss_pred             eeeecCCCeEEEEEEEcCCCCEE
Confidence            37999999999999764 45444


No 183
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription]
Probab=78.51  E-value=1.6  Score=29.17  Aligned_cols=16  Identities=44%  Similarity=0.953  Sum_probs=14.0

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|.+|.|||++-.
T Consensus        31 ~Ig~GTYG~VykA~~~   46 (438)
T KOG0666|consen   31 KIGRGTYGKVYKAVRK   46 (438)
T ss_pred             eecccccceeeEeeec
Confidence            6999999999999653


No 184
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=78.51  E-value=1.1  Score=28.14  Aligned_cols=15  Identities=33%  Similarity=0.716  Sum_probs=13.2

Q ss_pred             ccccccCceeeeEEE
Q 048032           71 DELGQGGYGRVYKGK   85 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~   85 (93)
                      +.||+|+||.||++.
T Consensus        11 ~~lg~G~~g~v~~~~   25 (296)
T cd05095          11 EKLGEGQFGEVHLCE   25 (296)
T ss_pred             eeccCCCCCeEEecc
Confidence            479999999999874


No 185
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms]
Probab=78.41  E-value=2.7  Score=28.99  Aligned_cols=17  Identities=35%  Similarity=0.857  Sum_probs=14.8

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      ++-+|.||.||+|.+.+
T Consensus       291 llqEGtFGri~~gI~~e  307 (563)
T KOG1024|consen  291 LLQEGTFGRIYRGIWRE  307 (563)
T ss_pred             hhhcCchhheeeeeecc
Confidence            68899999999998843


No 186
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=78.10  E-value=2.2  Score=27.70  Aligned_cols=21  Identities=29%  Similarity=0.407  Sum_probs=16.5

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||+|++|.||++.-. +|..+
T Consensus        23 ~lg~g~~g~V~~~~~~~~~~~v   44 (353)
T cd07850          23 PIGSGAQGIVCAAYDTVTGQNV   44 (353)
T ss_pred             EeccCCCEEEEEEEECCCCCEE
Confidence            7999999999999763 44443


No 187
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=77.86  E-value=1.6  Score=27.32  Aligned_cols=16  Identities=38%  Similarity=0.773  Sum_probs=14.4

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|++|.||++...
T Consensus        19 ~ig~g~~g~v~~~~~~   34 (293)
T cd05053          19 PLGEGAFGQVVKAEAV   34 (293)
T ss_pred             EecccccccEEEEEEe
Confidence            7999999999999763


No 188
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=77.14  E-value=1.3  Score=25.91  Aligned_cols=15  Identities=27%  Similarity=0.255  Sum_probs=6.7

Q ss_pred             HHHHHhhheeeeccC
Q 048032            9 IITCAIICIFRKKNN   23 (93)
Q Consensus         9 ~~~~~~~~~~~~~~~   23 (93)
                      ++.+++.+|..||++
T Consensus        44 iiivli~lcssRKkK   58 (189)
T PF05568_consen   44 IIIVLIYLCSSRKKK   58 (189)
T ss_pred             HHHHHHHHHhhhhHH
Confidence            333444455545443


No 189
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=77.12  E-value=2.2  Score=26.76  Aligned_cols=16  Identities=38%  Similarity=0.910  Sum_probs=14.1

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||++..
T Consensus        11 ~~lg~G~~~~v~~~~~   26 (288)
T cd05093          11 RELGEGAFGKVFLAEC   26 (288)
T ss_pred             cccCCcCCeeEEeeEe
Confidence            3799999999999975


No 190
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=77.03  E-value=4.5  Score=25.12  Aligned_cols=15  Identities=33%  Similarity=0.381  Sum_probs=13.2

Q ss_pred             ccccCceeeeEEEeC
Q 048032           73 LGQGGYGRVYKGKLS   87 (93)
Q Consensus        73 iG~G~~g~VYk~~l~   87 (93)
                      +|+|+||.||++...
T Consensus        24 lg~g~~g~v~~~~~~   38 (267)
T PHA03390         24 LIDGKFGKVSVLKHK   38 (267)
T ss_pred             ecCCCceEEEEEEEc
Confidence            699999999998763


No 191
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only]
Probab=76.92  E-value=0.99  Score=32.20  Aligned_cols=25  Identities=40%  Similarity=0.654  Sum_probs=18.2

Q ss_pred             hhccccccCceeeeEEEeC-CCeeeC
Q 048032           69 FKDELGQGGYGRVYKGKLS-DGRLVA   93 (93)
Q Consensus        69 f~~~iG~G~~g~VYk~~l~-~g~~va   93 (93)
                      |+++||+|.|=+||||.-. .|..||
T Consensus        44 ~~evLGrGafKtVYka~De~~giEVA   69 (632)
T KOG0584|consen   44 FDEVLGRGAFKTVYKAFDEEEGIEVA   69 (632)
T ss_pred             hhhhcccccceeeeeccccccchhhH
Confidence            4558999999999999653 344443


No 192
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=76.58  E-value=2.5  Score=26.86  Aligned_cols=20  Identities=30%  Similarity=0.720  Sum_probs=16.0

Q ss_pred             cccccCceeeeEEEeC-CCee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      .||+|++|.||+|... ++..
T Consensus        22 ~lg~g~~g~v~~~~~~~~~~~   42 (308)
T cd06634          22 EIGHGSFGAVYFARDVRNSEV   42 (308)
T ss_pred             heeeCCCEEEEEEEEcCCCcE
Confidence            7899999999999874 3443


No 193
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=76.44  E-value=1.4  Score=26.99  Aligned_cols=16  Identities=44%  Similarity=0.991  Sum_probs=14.7

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|++|.||++...
T Consensus        13 ~l~~g~~~~v~~~~~~   28 (275)
T cd06608          13 VIGEGTYGKVYKARHK   28 (275)
T ss_pred             eecCCCCeEEEEEEEC
Confidence            7999999999999874


No 194
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms]
Probab=75.99  E-value=1.8  Score=30.24  Aligned_cols=20  Identities=35%  Similarity=0.790  Sum_probs=16.1

Q ss_pred             chhc--cccccCceeeeEEEeC
Q 048032           68 SFKD--ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        68 ~f~~--~iG~G~~g~VYk~~l~   87 (93)
                      .|..  +||+||||.||-....
T Consensus       186 ~F~~~RvlGkGGFGEV~acqvr  207 (591)
T KOG0986|consen  186 TFRVYRVLGKGGFGEVCACQVR  207 (591)
T ss_pred             ceeeeEEEecccccceeEEEEe
Confidence            4665  8999999999977664


No 195
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=75.94  E-value=2.5  Score=26.47  Aligned_cols=20  Identities=30%  Similarity=0.481  Sum_probs=16.1

Q ss_pred             cccccCceeeeEEEeC-CCee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~   91 (93)
                      .||+|++|.||++... ++..
T Consensus        26 ~lg~g~~g~v~~~~~~~~~~~   46 (285)
T cd06648          26 KIGEGSTGIVCIATDKSTGRQ   46 (285)
T ss_pred             EeccCCCeEEEEEEECCCCCE
Confidence            7999999999999863 4443


No 196
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=75.93  E-value=1.8  Score=27.30  Aligned_cols=16  Identities=31%  Similarity=0.657  Sum_probs=13.9

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||++..
T Consensus        21 ~~lg~G~~g~Vy~~~~   36 (304)
T cd05101          21 KPLGEGCFGQVVMAEA   36 (304)
T ss_pred             ceeeccCCceEEEEEE
Confidence            3799999999999864


No 197
>KOG4258 consensus Insulin/growth factor receptor (contains protein kinase domain) [Signal transduction mechanisms]
Probab=75.08  E-value=7.2  Score=29.35  Aligned_cols=15  Identities=60%  Similarity=1.165  Sum_probs=13.5

Q ss_pred             cccccCceeeeEEEe
Q 048032           72 ELGQGGYGRVYKGKL   86 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l   86 (93)
                      .+|+|+||+||-|.-
T Consensus      1001 elg~gsfg~Vy~g~~ 1015 (1025)
T KOG4258|consen 1001 ELGQGSFGMVYEGNA 1015 (1025)
T ss_pred             hhccCccceEEEecC
Confidence            799999999998865


No 198
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=74.76  E-value=3  Score=26.37  Aligned_cols=21  Identities=33%  Similarity=0.599  Sum_probs=16.5

Q ss_pred             cccccCceeeeEEEe-CCCeee
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~v   92 (93)
                      .||.|++|.||++.- .+|+.+
T Consensus        26 ~lg~g~~g~vy~~~~~~~~~~v   47 (296)
T cd06655          26 KIGQGASGTVFTAIDVATGQEV   47 (296)
T ss_pred             EEecCCCeEEEEEEEcCCCcEE
Confidence            699999999999975 455544


No 199
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=74.45  E-value=2.3  Score=26.20  Aligned_cols=17  Identities=35%  Similarity=0.847  Sum_probs=14.9

Q ss_pred             hccccccCceeeeEEEe
Q 048032           70 KDELGQGGYGRVYKGKL   86 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l   86 (93)
                      .+.||+|+||.||+|..
T Consensus         9 ~~~lg~g~~g~v~~~~~   25 (267)
T cd05066           9 EKVIGAGEFGEVCSGRL   25 (267)
T ss_pred             eeeecccCCCceEEEEE
Confidence            44899999999999976


No 200
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=74.38  E-value=2.1  Score=27.11  Aligned_cols=16  Identities=31%  Similarity=0.733  Sum_probs=13.9

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|+||.||++..
T Consensus        41 ~~ig~G~~g~V~~~~~   56 (302)
T cd05055          41 KTLGAGAFGKVVEATA   56 (302)
T ss_pred             ceeeccCCeeEEEEEE
Confidence            3799999999999864


No 201
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms]
Probab=74.18  E-value=2.9  Score=30.68  Aligned_cols=18  Identities=33%  Similarity=0.700  Sum_probs=16.0

Q ss_pred             cccccCceeeeEEEeCCC
Q 048032           72 ELGQGGYGRVYKGKLSDG   89 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g   89 (93)
                      .|-+|||++||.+...++
T Consensus        44 vLAEGGFa~VYla~~~~~   61 (738)
T KOG1989|consen   44 VLAEGGFAQVYLAQDVKG   61 (738)
T ss_pred             EEccCCcEEEEEEEecCC
Confidence            699999999999988655


No 202
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=74.12  E-value=2  Score=26.71  Aligned_cols=16  Identities=31%  Similarity=0.422  Sum_probs=13.0

Q ss_pred             hccccccCceeeeEEE
Q 048032           70 KDELGQGGYGRVYKGK   85 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~   85 (93)
                      .+.||+|+||.||.+.
T Consensus         9 ~~~lg~g~~g~v~~~~   24 (283)
T cd05080           9 IRVLGEGHFGKVSLYC   24 (283)
T ss_pred             ceecccCCCcEEEEee
Confidence            3479999999998754


No 203
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=73.83  E-value=1.1  Score=29.19  Aligned_cols=12  Identities=17%  Similarity=0.302  Sum_probs=0.0

Q ss_pred             HHhhheeeeccC
Q 048032           12 CAIICIFRKKNN   23 (93)
Q Consensus        12 ~~~~~~~~~~~~   23 (93)
                      +++++|++|+++
T Consensus       164 iIa~icyrrkR~  175 (290)
T PF05454_consen  164 IIACICYRRKRK  175 (290)
T ss_dssp             ------------
T ss_pred             HHHHHhhhhhhc
Confidence            344444544444


No 204
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms]
Probab=73.73  E-value=2.2  Score=30.26  Aligned_cols=18  Identities=33%  Similarity=0.586  Sum_probs=15.2

Q ss_pred             hhccccccCceeeeEEEe
Q 048032           69 FKDELGQGGYGRVYKGKL   86 (93)
Q Consensus        69 f~~~iG~G~~g~VYk~~l   86 (93)
                      |.+.||+|+|++||++.-
T Consensus        77 Fg~~lGeGSYStV~~A~~   94 (604)
T KOG0592|consen   77 FGKILGEGSYSTVVLARE   94 (604)
T ss_pred             hhheeccccceeEEEeee
Confidence            445899999999999864


No 205
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair]
Probab=73.35  E-value=0.9  Score=30.85  Aligned_cols=16  Identities=31%  Similarity=0.704  Sum_probs=14.5

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|.|++||++.+.
T Consensus        43 kigeGsFssv~~a~~~   58 (418)
T KOG1167|consen   43 KIGEGSFSSVYKATDI   58 (418)
T ss_pred             cccccchhhhhhhhHh
Confidence            7999999999999874


No 206
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=73.25  E-value=2.3  Score=27.34  Aligned_cols=16  Identities=31%  Similarity=0.657  Sum_probs=13.8

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      ..||+|+||.||++.-
T Consensus        18 ~~ig~G~~g~v~~~~~   33 (334)
T cd05100          18 KPLGEGCFGQVVMAEA   33 (334)
T ss_pred             ceeccccCCcEEEEEE
Confidence            4799999999999863


No 207
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=73.23  E-value=1.1  Score=24.92  Aligned_cols=7  Identities=0%  Similarity=0.216  Sum_probs=0.0

Q ss_pred             hheeeec
Q 048032           15 ICIFRKK   21 (93)
Q Consensus        15 ~~~~~~~   21 (93)
                      .|+++|+
T Consensus        44 CWYckRR   50 (118)
T PF14991_consen   44 CWYCKRR   50 (118)
T ss_dssp             -------
T ss_pred             heeeeec
Confidence            3444433


No 208
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=72.99  E-value=2.4  Score=27.01  Aligned_cols=16  Identities=31%  Similarity=0.742  Sum_probs=13.9

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|++|.||++..
T Consensus        18 ~~lg~G~~g~vy~~~~   33 (314)
T cd05099          18 KPLGEGCFGQVVRAEA   33 (314)
T ss_pred             eeecCCCcccEEEeee
Confidence            3799999999999863


No 209
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=72.65  E-value=3.3  Score=27.69  Aligned_cols=22  Identities=41%  Similarity=0.632  Sum_probs=16.7

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||+|.||.||.|.- ..|..||
T Consensus        24 ~lG~GsfgkV~~a~~~~t~~~vA   46 (370)
T KOG0583|consen   24 TLGSGSFGKVKLAKHRLTGEKVA   46 (370)
T ss_pred             eecCCCCeeEEEeeeccCCCeEE
Confidence            699999999999965 3445443


No 210
>PF07204 Orthoreo_P10:  Orthoreovirus membrane fusion protein p10;  InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction [].
Probab=71.40  E-value=2.8  Score=22.59  Aligned_cols=10  Identities=30%  Similarity=0.531  Sum_probs=3.8

Q ss_pred             HHHHHhhhee
Q 048032            9 IITCAIICIF   18 (93)
Q Consensus         9 ~~~~~~~~~~   18 (93)
                      +++.+++|+.
T Consensus        56 Iii~Lv~CC~   65 (98)
T PF07204_consen   56 IIIALVCCCR   65 (98)
T ss_pred             HHHHHHHHhh
Confidence            3333333433


No 211
>PHA03207 serine/threonine kinase US3; Provisional
Probab=70.40  E-value=4  Score=27.05  Aligned_cols=15  Identities=27%  Similarity=0.379  Sum_probs=13.6

Q ss_pred             cccccCceeeeEEEe
Q 048032           72 ELGQGGYGRVYKGKL   86 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l   86 (93)
                      .||+|++|.||++..
T Consensus        99 ~Lg~G~~g~Vy~~~~  113 (392)
T PHA03207         99 SLTPGSEGEVFVCTK  113 (392)
T ss_pred             eecCCCCeEEEEEEE
Confidence            699999999999875


No 212
>PF11770 GAPT:  GRB2-binding adapter (GAPT);  InterPro: IPR021082  This entry represents a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells []. In contrast to other transmembrane adaptor proteins, GAPT, which this entry represents, is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region []. 
Probab=69.38  E-value=4.2  Score=23.88  Aligned_cols=17  Identities=18%  Similarity=0.749  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHhhheee
Q 048032            3 AGMMGIIITCAIICIFR   19 (93)
Q Consensus         3 ~~~~~~~~~~~~~~~~~   19 (93)
                      +.++++++++.+-|+|.
T Consensus        16 i~Ll~lLl~cgiGcvwh   32 (158)
T PF11770_consen   16 ISLLLLLLLCGIGCVWH   32 (158)
T ss_pred             HHHHHHHHHHhcceEEE
Confidence            33344444444444444


No 213
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=68.40  E-value=3.5  Score=25.83  Aligned_cols=16  Identities=38%  Similarity=0.910  Sum_probs=14.1

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|++|.||++..
T Consensus        11 ~~lg~g~~g~vy~~~~   26 (291)
T cd05094          11 RELGEGAFGKVFLAEC   26 (291)
T ss_pred             eeecccCCCeEEEeEe
Confidence            4899999999999874


No 214
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=68.10  E-value=5  Score=30.63  Aligned_cols=16  Identities=31%  Similarity=0.698  Sum_probs=14.4

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .||+|+||.||++...
T Consensus        20 kLG~GgFGtVYLAkdk   35 (1021)
T PTZ00266         20 KIGNGRFGEVFLVKHK   35 (1021)
T ss_pred             EEecCCCeEEEEEEEC
Confidence            7999999999999764


No 215
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=67.04  E-value=5.3  Score=24.34  Aligned_cols=17  Identities=41%  Similarity=0.829  Sum_probs=14.9

Q ss_pred             ccccccCceeeeEEEeC
Q 048032           71 DELGQGGYGRVYKGKLS   87 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l~   87 (93)
                      +.||.|++|.||++...
T Consensus         9 ~~l~~g~~~~v~~~~~~   25 (262)
T cd06613           9 QRIGSGTYGDVYKARDI   25 (262)
T ss_pred             EEecCCCceEEEEeEec
Confidence            47899999999999874


No 216
>PTZ00046 rifin; Provisional
Probab=66.14  E-value=3.2  Score=27.82  Aligned_cols=9  Identities=33%  Similarity=0.412  Sum_probs=3.5

Q ss_pred             HHHhhheee
Q 048032           11 TCAIICIFR   19 (93)
Q Consensus        11 ~~~~~~~~~   19 (93)
                      ++++++++|
T Consensus       331 MvIIYLILR  339 (358)
T PTZ00046        331 MVIIYLILR  339 (358)
T ss_pred             HHHHHHHHH
Confidence            333434443


No 217
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=63.57  E-value=4.8  Score=28.07  Aligned_cols=24  Identities=25%  Similarity=0.450  Sum_probs=18.7

Q ss_pred             hccccccCceeeeEE-EeCCCeeeC
Q 048032           70 KDELGQGGYGRVYKG-KLSDGRLVA   93 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~-~l~~g~~va   93 (93)
                      .++||.|..++||+| +.|.++.||
T Consensus        31 ~e~IG~G~sa~V~~A~c~p~~e~VA   55 (516)
T KOG0582|consen   31 QEVIGVGASAVVYLARCIPTNEVVA   55 (516)
T ss_pred             EEEEeccceeEeeeeeecccCCEEE
Confidence            348999999999998 446666664


No 218
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=63.12  E-value=3.9  Score=27.36  Aligned_cols=8  Identities=38%  Similarity=0.488  Sum_probs=3.1

Q ss_pred             HHhhheee
Q 048032           12 CAIICIFR   19 (93)
Q Consensus        12 ~~~~~~~~   19 (93)
                      +++++++|
T Consensus       327 vIIYLILR  334 (353)
T TIGR01477       327 VIIYLILR  334 (353)
T ss_pred             HHHHHHHH
Confidence            33333333


No 219
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms]
Probab=61.37  E-value=7.6  Score=28.28  Aligned_cols=25  Identities=32%  Similarity=0.577  Sum_probs=20.0

Q ss_pred             hhccccccCceeeeEEEeCCCeeeC
Q 048032           69 FKDELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        69 f~~~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      |.+.||+|.||.|-.+++.++..||
T Consensus       542 ~~ekiGeGqFGEVhLCeveg~lkVA  566 (807)
T KOG1094|consen  542 FKEKIGEGQFGEVHLCEVEGPLKVA  566 (807)
T ss_pred             hhhhhcCcccceeEEEEecCceEEE
Confidence            4557999999999999887766554


No 220
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]
Probab=61.20  E-value=5.2  Score=27.07  Aligned_cols=22  Identities=36%  Similarity=0.791  Sum_probs=17.2

Q ss_pred             cccccCceeeeEEE-eCCCeeeC
Q 048032           72 ELGQGGYGRVYKGK-LSDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~-l~~g~~va   93 (93)
                      .||+|.||..+.|. |-++++||
T Consensus        35 KIGeGsFG~lf~G~Nl~nne~VA   57 (449)
T KOG1165|consen   35 KIGEGSFGVLFLGKNLYNNEPVA   57 (449)
T ss_pred             ccccCcceeeecccccccCceEE
Confidence            79999999999885 34666665


No 221
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms]
Probab=61.03  E-value=8.9  Score=25.77  Aligned_cols=22  Identities=41%  Similarity=0.653  Sum_probs=17.5

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||+|.+|.|..+.- ++|..||
T Consensus        29 ~iG~GAyGvVcsA~~~~t~~~VA   51 (359)
T KOG0660|consen   29 PIGRGAYGVVCSAKDKRTGEKVA   51 (359)
T ss_pred             cccCcceeeEEEEEEcCCCCEee
Confidence            699999999998866 4566665


No 222
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=58.33  E-value=2.1  Score=31.41  Aligned_cols=16  Identities=50%  Similarity=0.976  Sum_probs=13.8

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .+|-|.||.|||++-.
T Consensus        39 ELGDGAFGKVyKA~nk   54 (1187)
T KOG0579|consen   39 ELGDGAFGKVYKAVNK   54 (1187)
T ss_pred             hhcCccchhhhhhhcc
Confidence            5799999999999754


No 223
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=57.85  E-value=6.2  Score=27.07  Aligned_cols=16  Identities=6%  Similarity=0.090  Sum_probs=14.0

Q ss_pred             ccccccCceeeeEEEe
Q 048032           71 DELGQGGYGRVYKGKL   86 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~l   86 (93)
                      +.||+|++|.||++.-
T Consensus        73 ~~lg~G~~g~vy~a~~   88 (478)
T PTZ00267         73 TLVGRNPTTAAFVATR   88 (478)
T ss_pred             EEEEeCCCcEEEEEEE
Confidence            3799999999999865


No 224
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]
Probab=57.18  E-value=9.5  Score=23.49  Aligned_cols=19  Identities=37%  Similarity=0.609  Sum_probs=16.5

Q ss_pred             cccccCceeeeEEEeCCCe
Q 048032           72 ELGQGGYGRVYKGKLSDGR   90 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~   90 (93)
                      .|++|.+|.||.|.+.++.
T Consensus        29 ~L~KG~~s~Vyl~~~~~~~   47 (201)
T COG2112          29 ELAKGTTSVVYLGEWRGGE   47 (201)
T ss_pred             hhhcccccEEEEeeccCce
Confidence            6999999999999887654


No 225
>KOG1236 consensus Predicted unusual protein kinase [General function prediction only]
Probab=56.27  E-value=2.6  Score=29.37  Aligned_cols=24  Identities=25%  Similarity=0.623  Sum_probs=18.0

Q ss_pred             HHHhcchhc-cccccCceeeeEEEe
Q 048032           63 KKMTNSFKD-ELGQGGYGRVYKGKL   86 (93)
Q Consensus        63 ~~at~~f~~-~iG~G~~g~VYk~~l   86 (93)
                      .++-.+|.+ .||.|+...||+|.+
T Consensus       186 ~eiF~efn~~PIGsG~IAQVY~atl  210 (565)
T KOG1236|consen  186 EEIFSEFNREPIGSGCIAQVYRATL  210 (565)
T ss_pred             HHHHHhcCCcccccchhhhhhhhhh
Confidence            333344554 799999999999987


No 226
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=55.13  E-value=9.3  Score=28.67  Aligned_cols=16  Identities=44%  Similarity=0.802  Sum_probs=13.8

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      ++|+|.+|+||-|.-.
T Consensus       582 VLGKGTYG~VYA~RD~  597 (1226)
T KOG4279|consen  582 VLGKGTYGTVYAARDM  597 (1226)
T ss_pred             EeecCceeEEEeeccc
Confidence            6999999999988643


No 227
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=53.49  E-value=9.6  Score=27.48  Aligned_cols=20  Identities=35%  Similarity=0.652  Sum_probs=16.3

Q ss_pred             cccccCceeeeEEEeCCCee
Q 048032           72 ELGQGGYGRVYKGKLSDGRL   91 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~~   91 (93)
                      .||+||.+.||++.-.+.+.
T Consensus       368 ~iG~GGSSkV~kV~~s~~~i  387 (677)
T KOG0596|consen  368 QIGSGGSSKVFKVLNSDKQI  387 (677)
T ss_pred             hhcCCCcceeeeeecCCCcc
Confidence            59999999999988765443


No 228
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]
Probab=52.72  E-value=12  Score=24.52  Aligned_cols=24  Identities=33%  Similarity=0.428  Sum_probs=20.3

Q ss_pred             hccccccCceeeeEEEeCCCeeeC
Q 048032           70 KDELGQGGYGRVYKGKLSDGRLVA   93 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~~g~~va   93 (93)
                      .+.||.|.=+.||.|..|+|..+|
T Consensus        96 G~~IGvGKEsdVY~~~~~~g~~~~  119 (304)
T COG0478          96 GTKIGVGKESDVYVAIDPKGRKVA  119 (304)
T ss_pred             ccccccCccceEEEEECCCCCEEE
Confidence            447999999999999999887653


No 229
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms]
Probab=50.69  E-value=10  Score=27.14  Aligned_cols=18  Identities=39%  Similarity=0.637  Sum_probs=15.4

Q ss_pred             hccccccCceeeeEEEeC
Q 048032           70 KDELGQGGYGRVYKGKLS   87 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l~   87 (93)
                      .+.+|+|.||.|++|.+.
T Consensus       301 ~~~lg~g~fG~v~~~~~~  318 (609)
T KOG0200|consen  301 GKYLGEGAFGQVVKALLF  318 (609)
T ss_pred             cceeecccccceEeEEEe
Confidence            347999999999999873


No 230
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms]
Probab=50.63  E-value=2.2  Score=29.96  Aligned_cols=14  Identities=50%  Similarity=0.952  Sum_probs=12.4

Q ss_pred             cccccCceeeeEEE
Q 048032           72 ELGQGGYGRVYKGK   85 (93)
Q Consensus        72 ~iG~G~~g~VYk~~   85 (93)
                      ++|+|||+.|||+.
T Consensus       470 LLGrGGFSEVyKAF  483 (775)
T KOG1151|consen  470 LLGRGGFSEVYKAF  483 (775)
T ss_pred             HhccccHHHHHHhc
Confidence            48999999999984


No 231
>PF15050 SCIMP:  SCIMP protein
Probab=50.50  E-value=15  Score=20.80  Aligned_cols=7  Identities=29%  Similarity=0.942  Sum_probs=2.8

Q ss_pred             Hhhheee
Q 048032           13 AIICIFR   19 (93)
Q Consensus        13 ~~~~~~~   19 (93)
                      +++|..+
T Consensus        26 IlyCvcR   32 (133)
T PF15050_consen   26 ILYCVCR   32 (133)
T ss_pred             HHHHHHH
Confidence            3344343


No 232
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only]
Probab=48.11  E-value=17  Score=25.16  Aligned_cols=17  Identities=41%  Similarity=0.626  Sum_probs=15.3

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      .+|.|..|+||.+.+.+
T Consensus        84 ~LG~GdiG~VyL~~l~~  100 (459)
T KOG0610|consen   84 RLGCGDIGTVYLVELRG  100 (459)
T ss_pred             HcCCCCceeEEEEEecC
Confidence            69999999999999964


No 233
>PF05084 GRA6:  Granule antigen protein (GRA6);  InterPro: IPR008119  Toxoplasma gondii is an obligate intracellular apicomplexan protozoan parasite, with a complex lifestyle involving varied hosts []. It has two phases of growth: an intestinal phase in feline hosts, and an extra-intestinal phase in other mammals. Oocysts from infected cats develop into tachyzoites, and eventually, bradyzoites and zoitocysts in the extraintestinal host []. Transmission of the parasite occurs through contact with infected cats or raw/undercooked meat; in immunocompromised individuals, it can cause severe and often lethal toxoplasmosis. Acute infection in healthy humans can sometimes also cause tissue damage [].  The protozoan utilises a variety of secretory and antigenic proteins to invade a host and gain access to the intracellular environment []. These originate from distinct organelles in the T. gondii cell termed micronemes, rhoptries, and dense granules. They are released at specific times during invasion to ensure the proteins are allocated to their correct target destinations []. Dense granule antigens (GRAs) are released from the T. gondii tachyzoite while still encapsulated in a host vacuole. Gra6, one of these moieties, is associated with the parasitophorous vacuole []. It possesses a hydrophobic central region flanked by two hydrophilic domains, and is present as a single copy gene in the Toxoplasma gondii genome []. Gra6 shares a similar function with Gra2, in that it is rapidly targeted to a network of membranous tubules that connect with the vacuolar membrane []. Indeed, these two proteins, together with Gra4, form a multimeric complex that stabilises the parasite within the vacuole.
Probab=47.66  E-value=13  Score=22.33  Aligned_cols=21  Identities=14%  Similarity=0.376  Sum_probs=11.4

Q ss_pred             ChHHHHHHHHHHHhhheeeec
Q 048032            1 LGAGMMGIIITCAIICIFRKK   21 (93)
Q Consensus         1 ~g~~~~~~~~~~~~~~~~~~~   21 (93)
                      ||++++++.+..+.+.|.+|.
T Consensus       154 IG~~VlA~~VA~L~~~F~RR~  174 (215)
T PF05084_consen  154 IGAVVLAVSVAMLTWFFLRRT  174 (215)
T ss_pred             HHHHHHHHHHHHHHHHHHHhh
Confidence            355556555555555555444


No 234
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms]
Probab=46.35  E-value=13  Score=24.60  Aligned_cols=21  Identities=29%  Similarity=0.569  Sum_probs=15.7

Q ss_pred             cccccCceeeeEEEeC-CCeee
Q 048032           72 ELGQGGYGRVYKGKLS-DGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~~v   92 (93)
                      .||.|.||.|+-..-| +|..|
T Consensus        60 PIGYGAFGVVWsVTDPRdgrrv   81 (449)
T KOG0664|consen   60 PIGYGAFGVVWSVTDPRSGKRV   81 (449)
T ss_pred             cccccceeEEEeccCCCCccch
Confidence            6999999999976554 45444


No 235
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=45.64  E-value=11  Score=26.37  Aligned_cols=26  Identities=31%  Similarity=0.520  Sum_probs=18.0

Q ss_pred             HHHHHhc-chhccccccCceeeeEEEe
Q 048032           61 NVKKMTN-SFKDELGQGGYGRVYKGKL   86 (93)
Q Consensus        61 ~l~~at~-~f~~~iG~G~~g~VYk~~l   86 (93)
                      +..++|+ ||-.+||+|+||.|..++-
T Consensus       344 d~i~~tDFnFl~VlGKGSFGKVlLaer  370 (683)
T KOG0696|consen  344 DRIKATDFNFLMVLGKGSFGKVLLAER  370 (683)
T ss_pred             cceeecccceEEEeccCccceeeeecc
Confidence            4444443 3445899999999987754


No 236
>PF13095 FTA2:  Kinetochore Sim4 complex subunit FTA2
Probab=45.01  E-value=24  Score=21.89  Aligned_cols=21  Identities=33%  Similarity=0.589  Sum_probs=17.0

Q ss_pred             hhccccccCc-eeeeEEEeCCC
Q 048032           69 FKDELGQGGY-GRVYKGKLSDG   89 (93)
Q Consensus        69 f~~~iG~G~~-g~VYk~~l~~g   89 (93)
                      |-+.+|.|.. |.|+|..+.+.
T Consensus        41 flefLg~g~~~~~V~kv~I~g~   62 (207)
T PF13095_consen   41 FLEFLGHGSHDGYVFKVEIDGR   62 (207)
T ss_pred             eeeecCCCCceeEEEEEEECCe
Confidence            3447999999 99999999543


No 237
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms]
Probab=44.55  E-value=16  Score=26.81  Aligned_cols=19  Identities=37%  Similarity=0.678  Sum_probs=16.3

Q ss_pred             cccccCceeeeEEEeCCCe
Q 048032           72 ELGQGGYGRVYKGKLSDGR   90 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~   90 (93)
                      -+|+|.-|.||.|.|.+.+
T Consensus       131 WlGSGaQGAVF~Grl~net  149 (904)
T KOG4721|consen  131 WLGSGAQGAVFLGRLHNET  149 (904)
T ss_pred             hhccCcccceeeeeccCce
Confidence            4899999999999996543


No 238
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=44.05  E-value=26  Score=21.85  Aligned_cols=20  Identities=15%  Similarity=0.184  Sum_probs=16.4

Q ss_pred             ccc-ccCceeeeEEEeCCCee
Q 048032           72 ELG-QGGYGRVYKGKLSDGRL   91 (93)
Q Consensus        72 ~iG-~G~~g~VYk~~l~~g~~   91 (93)
                      +|| .|+.|+||+...++++.
T Consensus        38 ~lg~~~g~gtv~~v~~~~~~~   58 (239)
T PRK01723         38 VVGSAKGRGTTWFVQTPGVNW   58 (239)
T ss_pred             eeecCCCCccEEEEEeCCceE
Confidence            688 99999999988876554


No 239
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms]
Probab=43.71  E-value=53  Score=22.06  Aligned_cols=16  Identities=38%  Similarity=0.619  Sum_probs=13.4

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      .+|.|+||.|-.....
T Consensus        51 tlGtGSFGrV~LVr~k   66 (355)
T KOG0616|consen   51 TLGTGSFGRVHLVREK   66 (355)
T ss_pred             eeccCccceEEEEEEc
Confidence            6999999999877663


No 240
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O). This domain has homology to domain II of the elongation factors EF-G and EF-2. Tet(M) and Tet(O) catalyze the release of tetracycline (Tc) from the ribosome in a GTP-dependent manner thereby mediating Tc resistance.  Tcs are broad-spectrum antibiotics.  Typical Tcs bind to the ribosome and inhibit the elongation phase of protein synthesis, by inhibiting the occupation of site A by aminoacyl-tRNA.
Probab=43.46  E-value=13  Score=19.20  Aligned_cols=21  Identities=29%  Similarity=0.286  Sum_probs=16.5

Q ss_pred             cccccCceeeeEEEeCCCeee
Q 048032           72 ELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      -.|+=.++.||.|.+..|..+
T Consensus        16 ~~G~la~~RV~sG~l~~g~~v   36 (85)
T cd03690          16 KGERLAYLRLYSGTLRLRDSV   36 (85)
T ss_pred             CCCeEEEEEEccCEEcCCCEE
Confidence            457778899999999877654


No 241
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms]
Probab=39.39  E-value=23  Score=25.31  Aligned_cols=22  Identities=41%  Similarity=0.611  Sum_probs=16.0

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .||+|..|.||-+.- ..+..||
T Consensus       280 kigqgaSG~vy~A~~~~~~~~Va  302 (550)
T KOG0578|consen  280 KIGQGATGGVYVARKISTKQEVA  302 (550)
T ss_pred             hhccccccceeeeeeccCCceEE
Confidence            699999999998743 3444443


No 242
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=39.24  E-value=27  Score=26.15  Aligned_cols=15  Identities=33%  Similarity=0.950  Sum_probs=6.1

Q ss_pred             HHHHHHHhhheeeec
Q 048032            7 GIIITCAIICIFRKK   21 (93)
Q Consensus         7 ~~~~~~~~~~~~~~~   21 (93)
                      +++++++++|+.+|+
T Consensus       286 vl~lL~vLl~yCrrk  300 (807)
T PF10577_consen  286 VLILLCVLLCYCRRK  300 (807)
T ss_pred             HHHHHHHHHHhhhcc
Confidence            333344444444443


No 243
>PRK11486 flagellar biosynthesis protein FliO; Provisional
Probab=38.23  E-value=20  Score=20.39  Aligned_cols=17  Identities=12%  Similarity=0.088  Sum_probs=8.2

Q ss_pred             HHHHHHHHHhhheeeec
Q 048032            5 MMGIIITCAIICIFRKK   21 (93)
Q Consensus         5 ~~~~~~~~~~~~~~~~~   21 (93)
                      ++++.+++++.|+.+|.
T Consensus        26 ~lVl~lI~~~aWLlkR~   42 (124)
T PRK11486         26 IGIIALILAAAWLVKRL   42 (124)
T ss_pred             HHHHHHHHHHHHHHHHc
Confidence            33444444555555553


No 244
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning]
Probab=36.31  E-value=3.3  Score=26.98  Aligned_cols=17  Identities=35%  Similarity=0.901  Sum_probs=14.7

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      .||+|.||.|+++.-.+
T Consensus        24 kigqGtfgeVFkAr~~n   40 (376)
T KOG0669|consen   24 KIGQGTFGEVFKARSKN   40 (376)
T ss_pred             hcCCchHHHHHHHhhcC
Confidence            79999999999987644


No 245
>TIGR01624 LRP1_Cterm LRP1 C-terminal domain. This model represents a tightly conserved small domain found in LRP1 and related plant proteins. This family also contains a well-conserved putative zinc finger domain (TIGR01623). The rest of the sequence of most members consists of highly divergent, low-complexity sequence.
Probab=36.03  E-value=30  Score=16.30  Aligned_cols=13  Identities=54%  Similarity=1.025  Sum_probs=10.2

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      .||    |+|+||.|-|
T Consensus        35 ~Ig----GHvFkGiLyD   47 (50)
T TIGR01624        35 TIG----GHVFKGFLHD   47 (50)
T ss_pred             EEC----ceEEeeEEec
Confidence            466    8999999844


No 246
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. In bacteria this translocation step is catalyzed by EF-G_GTP, which is hydrolyzed to provide the required energy. Thus, this action releases the uncharged tRNA from the P site and transfers the newly formed peptidyl-tRNA from the A site to the P site. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more compl
Probab=35.67  E-value=24  Score=17.87  Aligned_cols=21  Identities=33%  Similarity=0.591  Sum_probs=15.7

Q ss_pred             cccccCceeeeEEEeCCCeee
Q 048032           72 ELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      ..|+=.++.||.|.+..|..+
T Consensus        13 ~~G~~~~~Rv~sG~l~~g~~v   33 (83)
T cd04088          13 FVGKLSFVRVYSGTLKAGSTL   33 (83)
T ss_pred             CCceEEEEEEecCEEcCCCEE
Confidence            356667889999999777654


No 247
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=35.43  E-value=31  Score=23.51  Aligned_cols=24  Identities=33%  Similarity=0.613  Sum_probs=18.5

Q ss_pred             chHHHHHHhcchhccccccCceeeeEE
Q 048032           58 SFPNVKKMTNSFKDELGQGGYGRVYKG   84 (93)
Q Consensus        58 ~~~~l~~at~~f~~~iG~G~~g~VYk~   84 (93)
                      +|+|+-+-|   .+.+|+|.++.|--+
T Consensus        74 ~F~d~YkLt---~e~LGeGAyasVqtc   97 (463)
T KOG0607|consen   74 KFEDMYKLT---SELLGEGAYASVQTC   97 (463)
T ss_pred             hHHHHHHhH---HHHhcCccceeeeee
Confidence            467777777   458999999999654


No 248
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms]
Probab=35.23  E-value=30  Score=26.18  Aligned_cols=21  Identities=48%  Similarity=0.775  Sum_probs=15.6

Q ss_pred             cccccCcee-eeEEEeCCCeeeC
Q 048032           72 ELGQGGYGR-VYKGKLSDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~-VYk~~l~~g~~va   93 (93)
                      ++|.|..|+ ||+|..+ |+.||
T Consensus       516 ilG~Gs~Gt~Vf~G~ye-~R~VA  537 (903)
T KOG1027|consen  516 ILGYGSNGTVVFRGVYE-GREVA  537 (903)
T ss_pred             HcccCCCCcEEEEEeeC-Cceeh
Confidence            688888886 5899994 55564


No 249
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p.  This domain is homologous to domain II of the eukaryotic translational elongation factor EF-2.  Yeast Snu114p is essential for cell viability and for splicing in vivo. U5-116 kD binds GTP.  Experiments suggest that GTP binding and probably GTP hydrolysis is important for the function of the U5-116 kD/Snu114p.   In complex with GTP, EF-2 promotes the translocation step of translation. During translocation the peptidyl-tRNA is moved from the A site to the P site, the uncharged tRNA from the P site to the E-site and, the mRNA is shifted one codon relative to the ribosome.
Probab=35.14  E-value=27  Score=18.36  Aligned_cols=16  Identities=38%  Similarity=0.987  Sum_probs=12.5

Q ss_pred             CceeeeEEEeCCCeee
Q 048032           77 GYGRVYKGKLSDGRLV   92 (93)
Q Consensus        77 ~~g~VYk~~l~~g~~v   92 (93)
                      .++.||.|.+..|..+
T Consensus        19 a~~RV~sGtl~~g~~v   34 (94)
T cd04090          19 AFGRIYSGTIKKGQKV   34 (94)
T ss_pred             EEEEEeeCeEcCCCEE
Confidence            5788999999777654


No 250
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms]
Probab=34.50  E-value=22  Score=22.69  Aligned_cols=21  Identities=43%  Similarity=0.760  Sum_probs=15.7

Q ss_pred             cccccCceeeeEEEe-CCCeee
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~v   92 (93)
                      .||+|++|.|-+-.+ ++|...
T Consensus        53 elGrGayG~vekmrh~~sg~im   74 (282)
T KOG0984|consen   53 ELGRGAYGVVEKMRHIQSGTIM   74 (282)
T ss_pred             hhcCCccchhhheeeccCCeEE
Confidence            699999999876555 566654


No 251
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  No clear phenotype has been found for mutants in the yeast homologue of mtEFG2, MEF2.  There are two forms of mtEFG present in mammals (designated mtEFG1s and mtEFG2s) mtEFG1s are n
Probab=33.56  E-value=29  Score=17.65  Aligned_cols=21  Identities=33%  Similarity=0.567  Sum_probs=15.5

Q ss_pred             cccccCceeeeEEEeCCCeee
Q 048032           72 ELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      -.|+=.++.+|.|.|..|+.+
T Consensus        13 ~~g~i~~~Ri~sGtl~~g~~v   33 (83)
T cd04092          13 QRGPLTFVRVYSGTLKRGSAL   33 (83)
T ss_pred             CCCeEEEEEEecCEECCCCEE
Confidence            356667788999999777654


No 252
>PF13974 YebO:  YebO-like protein
Probab=32.93  E-value=23  Score=18.58  Aligned_cols=9  Identities=0%  Similarity=0.294  Sum_probs=3.3

Q ss_pred             HHHHHHHHh
Q 048032            6 MGIIITCAI   14 (93)
Q Consensus         6 ~~~~~~~~~   14 (93)
                      +++++.+++
T Consensus         6 ~~~lv~liv   14 (80)
T PF13974_consen    6 LVLLVGLIV   14 (80)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 253
>PF05142 DUF702:  Domain of unknown function (DUF702) ;  InterPro: IPR007818 This is a family of plant proteins of unknown function.
Probab=32.89  E-value=29  Score=20.54  Aligned_cols=13  Identities=54%  Similarity=1.037  Sum_probs=10.5

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      .||    |+||||.|-|
T Consensus       136 ~IG----GHVFKGiLYD  148 (154)
T PF05142_consen  136 NIG----GHVFKGILYD  148 (154)
T ss_pred             EEC----CEEeeeeeec
Confidence            377    9999999943


No 254
>KOG3482 consensus Small nuclear ribonucleoprotein (snRNP) SMF [RNA processing and modification]
Probab=32.35  E-value=31  Score=17.71  Aligned_cols=15  Identities=40%  Similarity=0.596  Sum_probs=11.0

Q ss_pred             cccccCceeeeEEEe
Q 048032           72 ELGQGGYGRVYKGKL   86 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l   86 (93)
                      ++-+=.+|..|||.|
T Consensus        21 V~vkLKwg~eYkG~L   35 (79)
T KOG3482|consen   21 VLVKLKWGQEYKGTL   35 (79)
T ss_pred             EEEEEecCcEEEEEE
Confidence            344456789999988


No 255
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. This translocation step is catalyzed by EF-2_GTP, which is hydrolyzed to provide the required energy. Thus, this action releases the uncharged tRNA from the P site and transfers the newly formed peptidyl-tRNA from the A site to the P site. Yeast Snu114p is essential for cell viability and for splicing in vivo. U5-116 kD binds GTP.  Experiments suggest that GTP binding and probably GTP hydrolysis is important for the function of the U5-116 kD/Snu114p.
Probab=31.26  E-value=33  Score=17.97  Aligned_cols=19  Identities=37%  Similarity=0.775  Sum_probs=13.7

Q ss_pred             cccCceeeeEEEeCCCeee
Q 048032           74 GQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        74 G~G~~g~VYk~~l~~g~~v   92 (93)
                      |+=+++.||.|.|..|..+
T Consensus        16 g~la~~RV~sGtl~~g~~v   34 (93)
T cd03700          16 GFIAFGRVFSGTIRKGQKV   34 (93)
T ss_pred             EEEEEEEEeeCeEeCCCEE
Confidence            4456788999999776543


No 256
>PF14531 Kinase-like:  Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=31.03  E-value=44  Score=21.84  Aligned_cols=21  Identities=24%  Similarity=0.525  Sum_probs=17.0

Q ss_pred             cccccCceeeeEEEeCC-Ceee
Q 048032           72 ELGQGGYGRVYKGKLSD-GRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~-g~~v   92 (93)
                      .||.|+++.||.++-++ |+..
T Consensus        19 ~i~~g~~~~v~~v~d~~t~~~~   40 (288)
T PF14531_consen   19 IIGKGGFSIVFEVTDVETGEEF   40 (288)
T ss_dssp             EEEEETTEEEEEEEETTTTEEE
T ss_pred             ccccCCceEEEEEEEccCCceE
Confidence            79999999999998754 5543


No 257
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]
Probab=31.02  E-value=31  Score=22.51  Aligned_cols=14  Identities=43%  Similarity=0.558  Sum_probs=12.6

Q ss_pred             cccccCceeeeEEE
Q 048032           72 ELGQGGYGRVYKGK   85 (93)
Q Consensus        72 ~iG~G~~g~VYk~~   85 (93)
                      .+|+|||..||.++
T Consensus        28 ~LgeGGfsfv~LV~   41 (302)
T KOG2345|consen   28 LLGEGGFSFVDLVK   41 (302)
T ss_pred             eecCCCceeeeeec
Confidence            68999999999876


No 258
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]
Probab=30.96  E-value=49  Score=23.15  Aligned_cols=22  Identities=36%  Similarity=0.542  Sum_probs=16.2

Q ss_pred             cccccCceeeeEEEe-CCCeeeC
Q 048032           72 ELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .+|+|+||.|-.|.= ..|..||
T Consensus       179 ~LGsGafg~Vkla~e~~tgk~vA  201 (475)
T KOG0615|consen  179 TLGSGAFGLVKLAYEKKTGKQVA  201 (475)
T ss_pred             eecCCceeEEEEEEEcccCcEEE
Confidence            599999999987754 3555554


No 259
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms]
Probab=30.49  E-value=80  Score=21.17  Aligned_cols=17  Identities=35%  Similarity=0.761  Sum_probs=14.6

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      .+|.|..|.|.+.....
T Consensus        99 dlGsGtcG~V~k~~~rs  115 (391)
T KOG0983|consen   99 DLGSGTCGQVWKMRFRS  115 (391)
T ss_pred             hhcCCCccceEEEEEcc
Confidence            68999999999987743


No 260
>PF15345 TMEM51:  Transmembrane protein 51
Probab=30.49  E-value=51  Score=20.95  Aligned_cols=7  Identities=29%  Similarity=0.487  Sum_probs=3.6

Q ss_pred             chHHHHH
Q 048032           58 SFPNVKK   64 (93)
Q Consensus        58 ~~~~l~~   64 (93)
                      +|+|++.
T Consensus       126 SYEEvv~  132 (233)
T PF15345_consen  126 SYEEVVN  132 (233)
T ss_pred             ChHHHHh
Confidence            4555543


No 261
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]
Probab=30.26  E-value=37  Score=26.86  Aligned_cols=17  Identities=24%  Similarity=0.499  Sum_probs=14.7

Q ss_pred             cccccCceeeeEEEeCC
Q 048032           72 ELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~   88 (93)
                      +||+|+||.|....+.+
T Consensus        82 vIGrGaFGEV~lVr~k~   98 (1317)
T KOG0612|consen   82 VIGRGAFGEVALVRHKS   98 (1317)
T ss_pred             HhcccccceeEEEEeec
Confidence            79999999999887743


No 262
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu and IF2 have all been demonstrated to interact at overlapping sites on the ribosome. Chemical protection studies demonstrate that they all include the universally conserved alpha-sarcin loop as part of their binding site. These data indicate that LepA may bind to this location on the ribosome as well.  LepA has never been observed in archaea, and eukaryl LepA is organellar. LepA is therefore a true bacterial GTPase, found only in the bacterial lineage.
Probab=29.49  E-value=34  Score=17.60  Aligned_cols=21  Identities=29%  Similarity=0.401  Sum_probs=15.7

Q ss_pred             cccccCceeeeEEEeCCCeee
Q 048032           72 ELGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g~~v   92 (93)
                      -.|+=.++.+|.|.+..|+.+
T Consensus        13 ~~G~i~~~Rv~sG~l~~~~~v   33 (86)
T cd03699          13 YRGVIALVRVFDGTLKKGDKI   33 (86)
T ss_pred             CCCEEEEEEEEcCEEcCCCEE
Confidence            456667889999999776654


No 263
>PRK15449 ferredoxin-like protein FixX; Provisional
Probab=29.35  E-value=33  Score=18.55  Aligned_cols=11  Identities=18%  Similarity=0.637  Sum_probs=8.7

Q ss_pred             ccccCceeeeE
Q 048032           73 LGQGGYGRVYK   83 (93)
Q Consensus        73 iG~G~~g~VYk   83 (93)
                      --+|+||..||
T Consensus        83 yPrgg~GV~yr   93 (95)
T PRK15449         83 YPRGTFGVEFR   93 (95)
T ss_pred             CCCCCcCEEEe
Confidence            45789998886


No 264
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=29.32  E-value=62  Score=20.42  Aligned_cols=16  Identities=6%  Similarity=-0.230  Sum_probs=13.4

Q ss_pred             cccccCceeeeEEEeC
Q 048032           72 ELGQGGYGRVYKGKLS   87 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~   87 (93)
                      ++|.|+||.||.....
T Consensus        38 ~l~~~~f~~v~l~~~~   53 (232)
T PRK10359         38 VFRNIDDTKVSLIDTD   53 (232)
T ss_pred             EecCCCceEEEEEecC
Confidence            6999999999986553


No 265
>PHA03286 envelope glycoprotein E; Provisional
Probab=29.06  E-value=29  Score=24.29  Aligned_cols=11  Identities=36%  Similarity=0.565  Sum_probs=5.5

Q ss_pred             eeeEEEeCCCe
Q 048032           80 RVYKGKLSDGR   90 (93)
Q Consensus        80 ~VYk~~l~~g~   90 (93)
                      .-|-+-|.+|.
T Consensus       472 ~~~~~~~~~~~  482 (492)
T PHA03286        472 SRYHAWLADGG  482 (492)
T ss_pred             chhhhhhhcCC
Confidence            34555555543


No 266
>PF15176 LRR19-TM:  Leucine-rich repeat family 19 TM domain
Probab=28.26  E-value=33  Score=18.82  Aligned_cols=11  Identities=9%  Similarity=0.268  Sum_probs=3.9

Q ss_pred             HHHHHHHHHhh
Q 048032            5 MMGIIITCAII   15 (93)
Q Consensus         5 ~~~~~~~~~~~   15 (93)
                      +.++++.++++
T Consensus        25 ~~al~~SlLIa   35 (102)
T PF15176_consen   25 VTALVTSLLIA   35 (102)
T ss_pred             HHHHHHHHHHH
Confidence            33333333333


No 267
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms]
Probab=28.24  E-value=17  Score=25.41  Aligned_cols=28  Identities=18%  Similarity=0.553  Sum_probs=20.7

Q ss_pred             eechHHHHHHhcchhccccccCceeeeEEEeCC
Q 048032           56 RYSFPNVKKMTNSFKDELGQGGYGRVYKGKLSD   88 (93)
Q Consensus        56 ~~~~~~l~~at~~f~~~iG~G~~g~VYk~~l~~   88 (93)
                      .|+.+|.+     |.+.||+|....||-+.+++
T Consensus       153 kFtiddye-----iG~~igkGC~AaVY~A~~~~  180 (598)
T KOG4158|consen  153 KFTIDDYE-----IGEFIGKGCNAAVYSARLAN  180 (598)
T ss_pred             ccchhhhc-----ccchhhccchhhhhhhhcCC
Confidence            46655543     34579999999999999864


No 268
>PF11395 DUF2873:  Protein of unknown function (DUF2873);  InterPro: IPR021532 This entry is represented by the human SARS coronavirus, Orf7b; it is a family of uncharacterised viral proteins.
Probab=27.94  E-value=54  Score=14.50  Aligned_cols=9  Identities=22%  Similarity=0.124  Sum_probs=3.8

Q ss_pred             HHHHhhhee
Q 048032           10 ITCAIICIF   18 (93)
Q Consensus        10 ~~~~~~~~~   18 (93)
                      ++.+++|+.
T Consensus        23 imliif~f~   31 (43)
T PF11395_consen   23 IMLIIFWFS   31 (43)
T ss_pred             HHHHHHHHH
Confidence            334444443


No 269
>PRK10905 cell division protein DamX; Validated
Probab=27.65  E-value=53  Score=21.97  Aligned_cols=9  Identities=22%  Similarity=0.877  Sum_probs=3.5

Q ss_pred             hHHHHHHHH
Q 048032            2 GAGMMGIII   10 (93)
Q Consensus         2 g~~~~~~~~   10 (93)
                      |+.++++++
T Consensus         3 GiGilVLlL   11 (328)
T PRK10905          3 GVGILVLLL   11 (328)
T ss_pred             chhHHHHHH
Confidence            443333333


No 270
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=26.27  E-value=66  Score=20.22  Aligned_cols=21  Identities=14%  Similarity=0.313  Sum_probs=12.3

Q ss_pred             chHHHHHHhcc---hhc------cccccCc
Q 048032           58 SFPNVKKMTNS---FKD------ELGQGGY   78 (93)
Q Consensus        58 ~~~~l~~at~~---f~~------~iG~G~~   78 (93)
                      +..|+.+|...   .++      .||.||-
T Consensus       151 DW~Em~~Ais~atgi~~~~mi~w~ign~G~  180 (217)
T PF07423_consen  151 DWNEMLKAISYATGISEDNMIVWFIGNNGS  180 (217)
T ss_pred             CHHHHHHHHHHhhCCChhheEEEhhhcCCc
Confidence            46677777532   221      2788876


No 271
>PRK11901 hypothetical protein; Reviewed
Probab=25.90  E-value=50  Score=22.10  Aligned_cols=10  Identities=20%  Similarity=0.717  Sum_probs=3.8

Q ss_pred             hHHHHHHHHH
Q 048032            2 GAGMMGIIIT   11 (93)
Q Consensus         2 g~~~~~~~~~   11 (93)
                      |+.+++++++
T Consensus        41 GiGilVLlLL   50 (327)
T PRK11901         41 GIGILVLLLL   50 (327)
T ss_pred             HHHHHHHHHH
Confidence            3333333333


No 272
>COG1504 Uncharacterized conserved protein [Function unknown]
Probab=24.98  E-value=1.1e+02  Score=17.31  Aligned_cols=30  Identities=10%  Similarity=0.287  Sum_probs=19.9

Q ss_pred             CCceechHHHHHHhcchhc--cccccCceeee
Q 048032           53 APKRYSFPNVKKMTNSFKD--ELGQGGYGRVY   82 (93)
Q Consensus        53 ~~~~~~~~~l~~at~~f~~--~iG~G~~g~VY   82 (93)
                      ..+.++.+|+......=.+  ++|.|-+|.+-
T Consensus        45 TSHkl~~eEle~~lee~~E~ivvGTG~~G~l~   76 (121)
T COG1504          45 TSHKLALEELEELLEEGPEVIVVGTGQSGMLE   76 (121)
T ss_pred             cccccCHHHHHHHHhcCCcEEEEecCceeEEE
Confidence            3466777787766542223  68999999774


No 273
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3). Termination of protein synthesis by the ribosome requires two release factor (RF) classes. The class II RF3 is a GTPase that removes class I RFs (RF1 or RF2) from the ribosome after release of the nascent polypeptide. RF3 in the GDP state binds to the ribosomal class I RF complex, followed by an exchange of GDP for GTP and release of the class I RF. Sequence comparison of class II release factors with elongation factors shows that prokaryotic RF3 is more similar to EF-G whereas eukaryotic eRF3 is more similar to eEF1A, implying that their precise function may differ.
Probab=24.23  E-value=42  Score=17.35  Aligned_cols=20  Identities=30%  Similarity=0.381  Sum_probs=14.4

Q ss_pred             ccccCceeeeEEEeCCCeee
Q 048032           73 LGQGGYGRVYKGKLSDGRLV   92 (93)
Q Consensus        73 iG~G~~g~VYk~~l~~g~~v   92 (93)
                      .|+=.++.+|.|.+..|..+
T Consensus        15 ~Gkla~~Rv~sG~l~~g~~v   34 (85)
T cd03689          15 RDRIAFVRVCSGKFERGMKV   34 (85)
T ss_pred             CcEEEEEEEECCEEcCCCEE
Confidence            46667788888888766654


No 274
>COG3761 NADH:ubiquinone oxidoreductase 17.2 kD subunit [Energy production and conversion]
Probab=23.81  E-value=34  Score=18.88  Aligned_cols=15  Identities=33%  Similarity=0.884  Sum_probs=12.3

Q ss_pred             hhccccccCceeeeE
Q 048032           69 FKDELGQGGYGRVYK   83 (93)
Q Consensus        69 f~~~iG~G~~g~VYk   83 (93)
                      |.+.+|+..||.+|.
T Consensus        12 fh~kvGeDefgN~Yy   26 (118)
T COG3761          12 FHKKVGEDEFGNVYY   26 (118)
T ss_pred             HHHhccchhccceee
Confidence            556789999999985


No 275
>COG3190 FliO Flagellar biogenesis protein [Cell motility and secretion]
Probab=23.63  E-value=50  Score=19.21  Aligned_cols=18  Identities=0%  Similarity=0.076  Sum_probs=8.1

Q ss_pred             HHHHHHHHHHhhheeeec
Q 048032            4 GMMGIIITCAIICIFRKK   21 (93)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~   21 (93)
                      +++++.++++.+|.++|.
T Consensus        31 L~~iL~lil~~~wl~kr~   48 (137)
T COG3190          31 LILILALILFLAWLVKRL   48 (137)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            333444444445555444


No 276
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms]
Probab=22.83  E-value=61  Score=24.89  Aligned_cols=21  Identities=43%  Similarity=0.974  Sum_probs=16.0

Q ss_pred             hccccccCceeeeEEEe-CCCe
Q 048032           70 KDELGQGGYGRVYKGKL-SDGR   90 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l-~~g~   90 (93)
                      -++||.|.+|.|||+.= .+|+
T Consensus        24 ~evig~Gtygkv~k~k~~~~~~   45 (953)
T KOG0587|consen   24 IEVIGNGTYGKVYKGRHVKTGQ   45 (953)
T ss_pred             EEEEeeccceeEEEEeeeecCc
Confidence            34799999999999864 3444


No 277
>PHA03240 envelope glycoprotein M; Provisional
Probab=22.28  E-value=65  Score=20.38  Aligned_cols=7  Identities=29%  Similarity=0.629  Sum_probs=2.6

Q ss_pred             HHhhhee
Q 048032           12 CAIICIF   18 (93)
Q Consensus        12 ~~~~~~~   18 (93)
                      +++++++
T Consensus       225 IIIL~cf  231 (258)
T PHA03240        225 VIILFFF  231 (258)
T ss_pred             HHHHHHH
Confidence            3333333


No 278
>PRK14051 negative regulator GrlR; Provisional
Probab=22.16  E-value=67  Score=17.95  Aligned_cols=18  Identities=33%  Similarity=0.586  Sum_probs=15.0

Q ss_pred             cccccCceeeeEEEeCCC
Q 048032           72 ELGQGGYGRVYKGKLSDG   89 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~~g   89 (93)
                      +|--|.++.+|.|.+.+.
T Consensus        30 kInGGD~~~~YqG~isEd   47 (123)
T PRK14051         30 MITGGDIASVYQGVLSED   47 (123)
T ss_pred             EecCCccceEEecccccc
Confidence            677889999999998654


No 279
>PF15569 Imm21:  Immunity protein 21
Probab=22.03  E-value=1.5e+02  Score=16.01  Aligned_cols=24  Identities=42%  Similarity=0.742  Sum_probs=16.5

Q ss_pred             eechHHHHHHhcchhc----cccccCceeeeE
Q 048032           56 RYSFPNVKKMTNSFKD----ELGQGGYGRVYK   83 (93)
Q Consensus        56 ~~~~~~l~~at~~f~~----~iG~G~~g~VYk   83 (93)
                      .++++|.++..+-+.+    ++|    |-||+
T Consensus        11 A~~~~dal~ii~~~~~~~i~ILG----GDVY~   38 (91)
T PF15569_consen   11 AYPFQDALKIINICEEKNIPILG----GDVYK   38 (91)
T ss_pred             ecCHHHHHHHHHHHHhcCceEEc----ceEEE
Confidence            4667777777665544    578    88994


No 280
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only]
Probab=21.28  E-value=53  Score=23.24  Aligned_cols=24  Identities=42%  Similarity=0.655  Sum_probs=17.3

Q ss_pred             hccccccCceeeeEEEe-CCCeeeC
Q 048032           70 KDELGQGGYGRVYKGKL-SDGRLVA   93 (93)
Q Consensus        70 ~~~iG~G~~g~VYk~~l-~~g~~va   93 (93)
                      .+.+|+|.||.|-++.- ..|..||
T Consensus        58 ~etLGkGTYGKVk~A~e~~sgR~VA   82 (668)
T KOG0611|consen   58 TETLGKGTYGKVKLAYEHKSGREVA   82 (668)
T ss_pred             HHHhcCCcccceeehhhccCCcEee
Confidence            34789999999987754 4566554


No 281
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]
Probab=21.17  E-value=13  Score=24.29  Aligned_cols=15  Identities=33%  Similarity=0.658  Sum_probs=12.8

Q ss_pred             ccccccCceeeeEEE
Q 048032           71 DELGQGGYGRVYKGK   85 (93)
Q Consensus        71 ~~iG~G~~g~VYk~~   85 (93)
                      ++||+|.|+.||+..
T Consensus        17 e~igkG~FSvVrRc~   31 (355)
T KOG0033|consen   17 EELGKGAFSVVRRCV   31 (355)
T ss_pred             HHHccCchHHHHHHH
Confidence            489999999999864


No 282
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=21.15  E-value=70  Score=25.89  Aligned_cols=19  Identities=32%  Similarity=0.639  Sum_probs=15.1

Q ss_pred             cccccCceeeeEEEeC-CCe
Q 048032           72 ELGQGGYGRVYKGKLS-DGR   90 (93)
Q Consensus        72 ~iG~G~~g~VYk~~l~-~g~   90 (93)
                      .||.|.||.||-+.-+ +|.
T Consensus      1242 ~Ig~G~fG~VYtavN~~tGe 1261 (1509)
T KOG4645|consen 1242 FIGGGTFGKVYTAVNLDTGE 1261 (1509)
T ss_pred             ccCCcceeeeEEeecCCccc
Confidence            5999999999987653 454


Done!