Citrus Sinensis ID: 048034


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
MSLTESCRNELRTAISQLNGRCLYSAAKWAAEQLVGIKQDPAKYTPSNTRFQRGSSSICRRFRTNEISSTLVAGVSYVSTPVMEEDEVVDSDFYLLAKSYFDCREYRRAAHVLRDQTGKKSVFLRCYALYLAGEKRKEEEMIELEGPLGKSDAVNRELISLERELSTLRKNGTMDPFILYLYGLVLKDKGSENLARTVLVESVNSYPWNWNSWLELQSLCTTIDILNSINLNNHWMKDFFLASTYQELRMHNEALTKYEYLQGTFGFSNYLQAQIAKAQYSLREFEQVEVVFEELLRNDPYRVEDMDMYSNVLYAKECFSALSYLAHRVFTTDKYRPESCCIIGNYYSLKGQHEKSVVYFRRALKLNKNYLSAWTLMGHEYKSIDYRAWYGLGQAYEMMHMPFYALHYFRKSVFLQPNDSRLWIAMAQCYETEQLHMLEEAIKCYRRAANCNDSEAIALNQLAKLHHALGRDEEAAFYYKKDLERMEAEEREGPNMVEALIFLATHCRAHNRFEDAEVYCTRLLDYTGPEKETAKSMLRGMRMAQSSFPAMDVEHFPP
cccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccc
***TESCRNELRTAISQLNGRCLYSAAKWAAEQLVGIKQDP**************************************TPVMEEDEVVDSDFYLLAKSYFDCREYRRAAHVLRDQTGKKSVFLRCYALYLAGEKRKEEEMIELEGPLGKSDAVNRELISLERELSTLRKNGTMDPFILYLYGLVLKDKGSENLARTVLVESVNSYPWNWNSWLELQSLCTTIDILNSINLNNHWMKDFFLASTYQELRMHNEALTKYEYLQGTFGFSNYLQAQIAKAQYSLREFEQVEVVFEELLRNDPYRVEDMDMYSNVLYAKECFSALSYLAHRVFTTDKYRPESCCIIGNYYSLKGQHEKSVVYFRRALKLNKNYLSAWTLMGHEYKSIDYRAWYGLGQAYEMMHMPFYALHYFRKSVFLQPNDSRLWIAMAQCYETEQLHMLEEAIKCYRRAANCNDSEAIALNQLAKLHHALGRDEEAAFYYKKDLERMEAEEREGPNMVEALIFLATHCRAHNRFEDAEVYCTRLLDYTGPEKETAKSML********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLTESCRNELRTAISQLNGRCLYSAAKWAAEQLVGIKQDPAKYTPSNTRFQRGSSSICRRFRTNEISSTLVAGVSYVSTPVMEEDEVVDSDFYLLAKSYFDCREYRRAAHVLRDQTGKKSVFLRCYALYLAGEKRKEEEMIELEGPLGKxxxxxxxxxxxxxxxxxxxxxGTMDPFILYLYGLVLKDKGSENLARTVLVESVNSYPWNWNSWLELQSLCTTIDILNSINLNNHWMKDFFLASTYQELRMHNEALTKYEYLQGTFGFSNYLQAQIAKAQYSLREFEQVEVVFEELLRNDPYRVEDMDMYSNVLYAKECFSALSYLAHRVFTTDKYRPESCCIIGNYYSLKGQHEKSVVYFRRALKLNKNYLSAWTLMGHEYKSIDYRAWYGLGQAYEMMHMPFYALHYFRKSVFLQPNDSRLWIAMAQCYETEQLHMLEEAIKCYRRAANCNDSEAIALNQLAKLHHALGRDEEAAFYYKKDLERMEAEEREGPNMVEALIFLATHCRAHNRFEDAEVYCTRLLDYTGPEKETAKSMLRGMRMAQSSFPAMDVEHFPP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Anaphase-promoting complex subunit 8 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication.confidentQ9STS3
Anaphase-promoting complex subunit 8 Component of the anaphase-promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome. Has a role in promoting metaphase to anaphase transition via the ubiquitination of specific mitotic substrates.probableO94556

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GW1, chain A
Confidence level:very confident
Coverage over the Query: 91-134,155-371,387-534
View the alignment between query and template
View the model in PyMOL
Template: 3FP2, chain A
Confidence level:very confident
Coverage over the Query: 175-216,242-534
View the alignment between query and template
View the model in PyMOL
Template: 2XPI, chain A
Confidence level:very confident
Coverage over the Query: 91-152,167-369,385-535
View the alignment between query and template
View the model in PyMOL
Template: 3FFL, chain A
Confidence level:probable
Coverage over the Query: 10-46,71-72,89-123,171-217
View the alignment between query and template
View the model in PyMOL