BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 048066
(72 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3E9H|A Chain A, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With L-Lysylsulfamoyl Adenosine
pdb|3E9H|B Chain B, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With L-Lysylsulfamoyl Adenosine
pdb|3E9H|C Chain C, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With L-Lysylsulfamoyl Adenosine
pdb|3E9H|D Chain D, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With L-Lysylsulfamoyl Adenosine
pdb|3E9I|A Chain A, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With L-Lysine Hydroxamate-Amp
pdb|3E9I|B Chain B, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With L-Lysine Hydroxamate-Amp
pdb|3E9I|C Chain C, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With L-Lysine Hydroxamate-Amp
pdb|3E9I|D Chain D, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With L-Lysine Hydroxamate-Amp
pdb|3A74|A Chain A, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With Diadenosine Tetraphosphate (Ap4a)
pdb|3A74|B Chain B, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With Diadenosine Tetraphosphate (Ap4a)
pdb|3A74|C Chain C, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With Diadenosine Tetraphosphate (Ap4a)
pdb|3A74|D Chain D, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
Complexed With Diadenosine Tetraphosphate (Ap4a)
Length = 493
Score = 25.8 bits (55), Expect = 6.7, Method: Composition-based stats.
Identities = 13/45 (28%), Positives = 23/45 (51%)
Query: 11 YNPLTTALQPRDKTWQGMKTVAELRREHNFSIPVNKDSLYKPIER 55
Y LT AL+P + + G+K + + R+ + +N +S I R
Sbjct: 133 YEFLTKALRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKKTFITR 177
>pdb|2UWF|A Chain A, Crystal Structure Of Family 10 Xylanase From Bacillus
Halodurans
Length = 356
Score = 25.4 bits (54), Expect = 8.2, Method: Composition-based stats.
Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 2/28 (7%)
Query: 17 ALQPRDK--TWQGMKTVAELRREHNFSI 42
+LQPR+ W+G + E R+HN +
Sbjct: 55 SLQPREGEWNWEGADKIVEFARKHNMEL 82
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.138 0.462
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,385,214
Number of Sequences: 62578
Number of extensions: 82132
Number of successful extensions: 124
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 122
Number of HSP's gapped (non-prelim): 3
length of query: 72
length of database: 14,973,337
effective HSP length: 42
effective length of query: 30
effective length of database: 12,345,061
effective search space: 370351830
effective search space used: 370351830
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)