BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048066
         (72 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3E9H|A Chain A, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With L-Lysylsulfamoyl Adenosine
 pdb|3E9H|B Chain B, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With L-Lysylsulfamoyl Adenosine
 pdb|3E9H|C Chain C, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With L-Lysylsulfamoyl Adenosine
 pdb|3E9H|D Chain D, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With L-Lysylsulfamoyl Adenosine
 pdb|3E9I|A Chain A, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With L-Lysine Hydroxamate-Amp
 pdb|3E9I|B Chain B, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With L-Lysine Hydroxamate-Amp
 pdb|3E9I|C Chain C, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With L-Lysine Hydroxamate-Amp
 pdb|3E9I|D Chain D, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With L-Lysine Hydroxamate-Amp
 pdb|3A74|A Chain A, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With Diadenosine Tetraphosphate (Ap4a)
 pdb|3A74|B Chain B, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With Diadenosine Tetraphosphate (Ap4a)
 pdb|3A74|C Chain C, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With Diadenosine Tetraphosphate (Ap4a)
 pdb|3A74|D Chain D, Lysyl-Trna Synthetase From Bacillus Stearothermophilus
           Complexed With Diadenosine Tetraphosphate (Ap4a)
          Length = 493

 Score = 25.8 bits (55), Expect = 6.7,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 23/45 (51%)

Query: 11  YNPLTTALQPRDKTWQGMKTVAELRREHNFSIPVNKDSLYKPIER 55
           Y  LT AL+P  + + G+K + +  R+    + +N +S    I R
Sbjct: 133 YEFLTKALRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKKTFITR 177


>pdb|2UWF|A Chain A, Crystal Structure Of Family 10 Xylanase From Bacillus
          Halodurans
          Length = 356

 Score = 25.4 bits (54), Expect = 8.2,   Method: Composition-based stats.
 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 17 ALQPRDK--TWQGMKTVAELRREHNFSI 42
          +LQPR+    W+G   + E  R+HN  +
Sbjct: 55 SLQPREGEWNWEGADKIVEFARKHNMEL 82


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.138    0.462 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,385,214
Number of Sequences: 62578
Number of extensions: 82132
Number of successful extensions: 124
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 122
Number of HSP's gapped (non-prelim): 3
length of query: 72
length of database: 14,973,337
effective HSP length: 42
effective length of query: 30
effective length of database: 12,345,061
effective search space: 370351830
effective search space used: 370351830
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)