BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048096
         (530 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3I0O|A Chain A, Crystal Structure Of Spectinomycin Phosphotransferase,
           Aph(9)-Ia, In Complex With Adp And Spectinomcyin
 pdb|3I0Q|A Chain A, Crystal Structure Of The Amp-Bound Complex Of
           Spectinomycin Phosphotransferase, Aph(9)-Ia
 pdb|3I1A|A Chain A, Crystal Structure Of Apo Spectinomycin Phosphotransferase,
           Aph(9)-Ia
 pdb|3I1A|B Chain B, Crystal Structure Of Apo Spectinomycin Phosphotransferase,
           Aph(9)-Ia
 pdb|3Q2M|A Chain A, Crystal Structure Of Spectinomycin Phosphotransferase,
           Aph(9)-Ia, Protein Kinase Inhibitor Cki-7 Complex
          Length = 339

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 256 QSIENQLPYNISPFWIRARFFKQLNEEGVLVLKGLDT--KLSKNLPPDLQK-LRCKVAFH 312
           +S  NQ+ ++ S   + A F    N+    + + +DT  KLSK + PDL K + C    H
Sbjct: 155 RSFYNQIEFDNSDDKLTAAFKSFFNQNSAAIHRLVDTSEKLSKKIQPDLDKYVLCHSDIH 214

Query: 313 A 313
           A
Sbjct: 215 A 215


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,916,357
Number of Sequences: 62578
Number of extensions: 525582
Number of successful extensions: 1019
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1019
Number of HSP's gapped (non-prelim): 2
length of query: 530
length of database: 14,973,337
effective HSP length: 103
effective length of query: 427
effective length of database: 8,527,803
effective search space: 3641371881
effective search space used: 3641371881
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)