BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 048096
(530 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3I0O|A Chain A, Crystal Structure Of Spectinomycin Phosphotransferase,
Aph(9)-Ia, In Complex With Adp And Spectinomcyin
pdb|3I0Q|A Chain A, Crystal Structure Of The Amp-Bound Complex Of
Spectinomycin Phosphotransferase, Aph(9)-Ia
pdb|3I1A|A Chain A, Crystal Structure Of Apo Spectinomycin Phosphotransferase,
Aph(9)-Ia
pdb|3I1A|B Chain B, Crystal Structure Of Apo Spectinomycin Phosphotransferase,
Aph(9)-Ia
pdb|3Q2M|A Chain A, Crystal Structure Of Spectinomycin Phosphotransferase,
Aph(9)-Ia, Protein Kinase Inhibitor Cki-7 Complex
Length = 339
Score = 28.5 bits (62), Expect = 8.9, Method: Compositional matrix adjust.
Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
Query: 256 QSIENQLPYNISPFWIRARFFKQLNEEGVLVLKGLDT--KLSKNLPPDLQK-LRCKVAFH 312
+S NQ+ ++ S + A F N+ + + +DT KLSK + PDL K + C H
Sbjct: 155 RSFYNQIEFDNSDDKLTAAFKSFFNQNSAAIHRLVDTSEKLSKKIQPDLDKYVLCHSDIH 214
Query: 313 A 313
A
Sbjct: 215 A 215
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.135 0.397
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,916,357
Number of Sequences: 62578
Number of extensions: 525582
Number of successful extensions: 1019
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1019
Number of HSP's gapped (non-prelim): 2
length of query: 530
length of database: 14,973,337
effective HSP length: 103
effective length of query: 427
effective length of database: 8,527,803
effective search space: 3641371881
effective search space used: 3641371881
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)