Citrus Sinensis ID: 048097

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----

MKAIQFLIGFALFALASSLASAYDPSPLQDICVAIIDHKDGVFVNGKFCKDPKLAKAEDFFLSGLDKPGNTENRLGFNVTNANVEQIPGLNTLGTSAVRIDYAPYGQNPPHTHPRATEILVVLEGTLYVGFVTSNQLNNTLIAKVLNKGDVFVFPIGLIHFQVNIGKTSAVAFAGFSSQFPGVITIADTVFGANPPINPDFLGKAFQLDPKIVKDLQDKFINGN

ccHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccCEEEEEEEccccccccccccccccEEEEEEcEEEEEEEEccccccEEEEEEEEcccEEEEccccEEEEEEcccccEEEEEEEcccccccEEHHHHHHcccccccHHHHHHHccccHHHHHHHHHHccccc

***IQFLIGFALFALASSLASAYDPSPLQDICVAIIDHKDGVFVNGKFCKDPKLAKAEDFFLSGLDKPGNTENRLGFNVTNANVEQIPGLNTLGTSAVRIDYAPYGQNPPHTHPRATEILVVLEGTLYVGFVTSNQLNNTLIAKVLNKGDVFVFPIGLIHFQVNIGKTSAVAFAGFSSQFPGVITIADTVFGANPPINPDFLGKAFQLDPKIVKDLQDKFI***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Germin-like protein subfamily 1 member 14	May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.	confident	Q9FID0
Germin-like protein subfamily 1 member 13	May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.	confident	P92997
Putative germin-like protein 2-1	May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.	probable	Q6K5Q0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FI2, chain A
Confidence level:very confident
Coverage over the Query: 23-223
View the alignment between query and template
View the model in PyMOL