Query         048115
Match_columns 94
No_of_seqs    122 out of 131
Neff          4.1 
Searched_HMMs 46136
Date          Fri Mar 29 06:24:06 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048115.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048115hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06522 B12D:  NADH-ubiquinone  99.9 1.3E-25 2.8E-30  145.7   3.7   72    4-84      1-72  (73)
  2 PF06679 DUF1180:  Protein of u  75.2       2 4.4E-05   32.0   1.8   35   12-52     98-135 (163)
  3 PF01307 Plant_vir_prot:  Plant  73.8     2.9 6.4E-05   28.9   2.2   19   12-30     12-30  (104)
  4 PF08216 CTNNBL:  Catenin-beta-  69.3     2.6 5.5E-05   29.7   1.1   20    6-25     76-95  (108)
  5 PF05251 UPF0197:  Uncharacteri  68.7     6.1 0.00013   26.4   2.8   29    5-33     11-41  (77)
  6 PF14880 COX14:  Cytochrome oxi  54.8      13 0.00029   22.8   2.4   27    9-35     18-44  (59)
  7 PF03672 UPF0154:  Uncharacteri  49.7      15 0.00034   23.7   2.1   12   22-33     12-23  (64)
  8 PF10661 EssA:  WXG100 protein   46.8      21 0.00046   25.8   2.7   19   14-32    126-144 (145)
  9 PF13056 DUF3918:  Protein of u  40.7      26 0.00057   21.1   2.0   16   14-29      7-22  (43)
 10 PRK13755 putative mercury tran  40.2      34 0.00075   25.2   2.9   22    9-30     53-74  (139)
 11 PF05751 FixH:  FixH;  InterPro  38.9     8.8 0.00019   26.1  -0.3   41   12-62      8-49  (146)
 12 PRK13887 conjugal transfer pro  37.5      72  0.0016   24.4   4.5   15   55-69    108-122 (250)
 13 PF05961 Chordopox_A13L:  Chord  36.6      60  0.0013   21.4   3.3   23   12-34      7-29  (68)
 14 COG3763 Uncharacterized protei  36.4      23  0.0005   23.4   1.4   28    4-34      4-31  (71)
 15 COG3766 Predicted membrane pro  36.2      22 0.00047   26.1   1.3   38   12-49     78-115 (133)
 16 PF09919 DUF2149:  Uncharacteri  35.6      39 0.00085   22.8   2.5   33   14-46     14-46  (92)
 17 PF12454 Ecm33:  GPI-anchored c  31.7      76  0.0016   18.8   2.9   32    9-47      7-38  (40)
 18 PF11084 DUF2621:  Protein of u  31.6      53  0.0011   24.3   2.7   33   10-46     11-43  (141)
 19 PHA02681 ORF089 virion membran  30.4      69  0.0015   22.1   3.0   29   14-42     10-39  (92)
 20 PF08602 Mgr1:  Mgr1-like, i-AA  30.2      76  0.0017   26.7   3.8   17   15-31     62-78  (363)
 21 PRK11677 hypothetical protein;  29.8      34 0.00073   24.7   1.5   22   14-37      6-28  (134)
 22 PF15114 UPF0640:  Uncharacteri  29.7      31 0.00068   22.7   1.2   12    9-20     26-37  (69)
 23 PF14654 Epiglycanin_C:  Mucin,  29.2      50  0.0011   23.3   2.2   17   16-32     30-46  (106)
 24 PF03650 MPC:  Uncharacterised   28.9      62  0.0013   23.2   2.7   30    5-34     67-96  (119)
 25 PF06295 DUF1043:  Protein of u  28.3      30 0.00065   24.2   1.0   15   15-29      3-18  (128)
 26 PF10883 DUF2681:  Protein of u  28.3      75  0.0016   21.5   2.9   18   12-29      7-24  (87)
 27 PF09849 DUF2076:  Uncharacteri  27.8      63  0.0014   25.5   2.8   23   12-34    142-164 (247)
 28 PF11833 DUF3353:  Protein of u  26.8      56  0.0012   24.6   2.3   15   16-30    121-135 (194)
 29 PF08114 PMP1_2:  ATPase proteo  26.8      64  0.0014   19.5   2.1   27    6-32      7-34  (43)
 30 PF11346 DUF3149:  Protein of u  26.2   1E+02  0.0022   18.3   2.8   21   15-35     18-41  (42)
 31 PF06450 NhaB:  Bacterial Na+/H  25.8      26 0.00057   30.5   0.4   50   17-69    155-204 (515)
 32 PF14962 AIF-MLS:  Mitochondria  25.5      23  0.0005   27.0   0.0   27   10-36     46-72  (180)
 33 PF11654 DUF2665:  Protein of u  25.4      72  0.0016   19.5   2.1   16   15-30     10-25  (47)
 34 PF12286 DUF3622:  Protein of u  25.2      58  0.0013   21.6   1.8   41   26-70     21-61  (71)
 35 PF12732 YtxH:  YtxH-like prote  25.0      82  0.0018   19.6   2.5   16   12-27      3-18  (74)
 36 PF15050 SCIMP:  SCIMP protein   24.9 1.2E+02  0.0025   22.3   3.5   64    4-79      9-73  (133)
 37 COG3592 Uncharacterized conser  24.9      33  0.0007   22.9   0.6   10   68-77     41-50  (74)
 38 PF04550 Phage_holin_2:  Phage   24.4      80  0.0017   21.7   2.4   23    7-29     57-80  (89)
 39 KOG2802 Membrane protein HUEL   24.1      67  0.0015   27.9   2.5   22   13-35    368-389 (503)
 40 PF08009 CDP-OH_P_tran_2:  CDP-  24.1      86  0.0019   18.3   2.2   14    9-22      5-18  (39)
 41 PF13400 Tad:  Putative Flp pil  23.4 1.3E+02  0.0027   17.2   2.9   21    9-29     11-31  (48)
 42 PRK11089 PTS system glucose-sp  22.8      56  0.0012   27.9   1.8   14   10-23     59-72  (477)
 43 PF14990 DUF4516:  Domain of un  22.6 1.1E+02  0.0025   18.6   2.7   30   10-40     10-39  (47)
 44 TIGR02005 PTS-IIBC-alpha PTS s  21.6      57  0.0012   28.2   1.6   14   10-23     65-78  (524)
 45 PF10177 DUF2371:  Uncharacteri  21.6      31 0.00067   25.3   0.0   17   12-28     48-64  (141)
 46 PF14155 DUF4307:  Domain of un  21.4 1.1E+02  0.0023   21.0   2.7   24   12-35     10-33  (112)
 47 KOG3491 Predicted membrane pro  21.2      93   0.002   20.2   2.2   21   12-32     42-62  (65)
 48 PF10828 DUF2570:  Protein of u  20.9 1.2E+02  0.0025   20.6   2.7   19   10-28      4-22  (110)
 49 TIGR02003 PTS-II-BC-unk1 PTS s  20.5      67  0.0014   28.0   1.8   14   10-23     63-76  (548)
 50 PF10269 Tmemb_185A:  Transmemb  20.2      72  0.0016   24.3   1.8   22   10-31    151-172 (238)
 51 PF14898 DUF4491:  Domain of un  20.2 1.2E+02  0.0025   21.1   2.6   21    8-28     33-53  (94)
 52 PLN02949 transferase, transfer  20.1   1E+02  0.0022   25.6   2.7   39    2-42    107-147 (463)

No 1  
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=99.91  E-value=1.3e-25  Score=145.73  Aligned_cols=72  Identities=39%  Similarity=0.576  Sum_probs=69.4

Q ss_pred             ccCcchhhHHHHHHHHHHHHHHhhhhhhccCCceeeecCCCCCcccchhHhhhhhhhhhhhHhhhcCCCCcccccccccC
Q 048115            4 WMRPEVYPLMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHGLRRFLRTRPPQVMPAINRFFT   83 (94)
Q Consensus         4 Wi~pEvyPL~~avgvAvg~~~~~~~R~l~~nP~vRv~K~~R~~gv~en~~EG~~y~~H~~Rr~~~~~~p~imp~~n~~f~   83 (94)
                      |.+|||||||++||+|+|+|+|+++|++++||||+|+|++|       .+++++|++|..|||++.+. +|||.+|++ +
T Consensus         1 ~~~pel~PL~~~vg~a~~~a~~~~~r~l~~~PdV~~~k~~~-------~~pw~~~~~~~~~K~~~~~~-~~~~~~~~~-p   71 (73)
T PF06522_consen    1 KKHPELYPLFVIVGVAVGGATFYLYRLLLTNPDVRWNKKNR-------PEPWEKYKPHEQRKFYSINQ-DYMPLKNNF-P   71 (73)
T ss_pred             CCCccccchHHHHHHHHHHHHHHHHHHHhcCCCeEEEecCC-------cChhhhcCccccEEeecccc-ccccccccC-C
Confidence            89999999999999999999999999999999999999999       68999999999999999999 999999998 6


Q ss_pred             C
Q 048115           84 Q   84 (94)
Q Consensus        84 ~   84 (94)
                      |
T Consensus        72 d   72 (73)
T PF06522_consen   72 D   72 (73)
T ss_pred             C
Confidence            5


No 2  
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=75.19  E-value=2  Score=31.95  Aligned_cols=35  Identities=23%  Similarity=0.397  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHHHhhhhhhccCCceeeec---CCCCCcccchh
Q 048115           12 LMAAMTFVASMCVFQLTRNVLLNPDVRINK---GRRSMGVLENE   52 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~R~l~~nP~vRv~K---~~R~~gv~en~   52 (94)
                      +++.+|+...+.+|+++|      .+|+.|   .-|+.|++.+-
T Consensus        98 ~~Vl~g~s~l~i~yfvir------~~R~r~~~rktRkYgvl~~~  135 (163)
T PF06679_consen   98 LYVLVGLSALAILYFVIR------TFRLRRRNRKTRKYGVLTTR  135 (163)
T ss_pred             HHHHHHHHHHHHHHHHHH------HHhhccccccceeecccCCC
Confidence            578888888889999999      455554   33678887654


No 3  
>PF01307 Plant_vir_prot:  Plant viral movement protein;  InterPro: IPR001896 This family of membrane/coat proteins are found in a number of different ssRNA plant virus families that include Potexvirus, Hordeivirus and Carlavirus.
Probab=73.83  E-value=2.9  Score=28.89  Aligned_cols=19  Identities=37%  Similarity=0.569  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHhhhhh
Q 048115           12 LMAAMTFVASMCVFQLTRN   30 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~R~   30 (94)
                      |.+|+|++++++.|.+.|+
T Consensus        12 l~~aiG~~lal~i~~ltr~   30 (104)
T PF01307_consen   12 LAAAIGVSLALIIFTLTRS   30 (104)
T ss_pred             hHHHHHHHHHHHHHHhhcC
Confidence            6789999999999999995


No 4  
>PF08216 CTNNBL:  Catenin-beta-like, Arm-motif containing nuclear;  InterPro: IPR013180 This domain is found in eukaryotic proteins. A human nuclear protein with this domain (Q8WYA6 from SWISSPROT) is thought to have a role in apoptosis [].
Probab=69.26  E-value=2.6  Score=29.67  Aligned_cols=20  Identities=30%  Similarity=0.554  Sum_probs=16.3

Q ss_pred             CcchhhHHHHHHHHHHHHHH
Q 048115            6 RPEVYPLMAAMTFVASMCVF   25 (94)
Q Consensus         6 ~pEvyPL~~avgvAvg~~~~   25 (94)
                      -||+||+|+-+|++..+++.
T Consensus        76 ~P~LYp~lv~l~~v~sL~~L   95 (108)
T PF08216_consen   76 APELYPELVELGAVPSLLGL   95 (108)
T ss_pred             ChhHHHHHHHcCCHHHHHHH
Confidence            58999999999977766653


No 5  
>PF05251 UPF0197:  Uncharacterised protein family (UPF0197);  InterPro: IPR007915 This family of proteins is functionally uncharacterised, but is thought to be a transmembrane protein.
Probab=68.65  E-value=6.1  Score=26.39  Aligned_cols=29  Identities=17%  Similarity=0.411  Sum_probs=20.9

Q ss_pred             cCcchhhHHHHHHHHHHHH--HHhhhhhhcc
Q 048115            5 MRPEVYPLMAAMTFVASMC--VFQLTRNVLL   33 (94)
Q Consensus         5 i~pEvyPL~~avgvAvg~~--~~~~~R~l~~   33 (94)
                      |+|++||.++.+-.++|++  +++.+..++.
T Consensus        11 V~p~~~p~La~vll~iGl~fta~Ffiyevts   41 (77)
T PF05251_consen   11 VNPALYPHLAVVLLAIGLFFTAWFFIYEVTS   41 (77)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            4789999999988877665  4555664543


No 6  
>PF14880 COX14:  Cytochrome oxidase c assembly
Probab=54.81  E-value=13  Score=22.84  Aligned_cols=27  Identities=15%  Similarity=0.231  Sum_probs=23.0

Q ss_pred             hhhHHHHHHHHHHHHHHhhhhhhccCC
Q 048115            9 VYPLMAAMTFVASMCVFQLTRNVLLNP   35 (94)
Q Consensus         9 vyPL~~avgvAvg~~~~~~~R~l~~nP   35 (94)
                      |+=|+.+.+++.++|+|+.++++..+.
T Consensus        18 V~~Lig~T~~~g~~~~~~~y~~~~~~r   44 (59)
T PF14880_consen   18 VLGLIGFTVYGGGLTVYTVYSYFKYNR   44 (59)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            577888999999999999999877664


No 7  
>PF03672 UPF0154:  Uncharacterised protein family (UPF0154);  InterPro: IPR005359 The proteins in this entry are functionally uncharacterised.
Probab=49.66  E-value=15  Score=23.67  Aligned_cols=12  Identities=17%  Similarity=0.263  Sum_probs=7.2

Q ss_pred             HHHHhhhhhhcc
Q 048115           22 MCVFQLTRNVLL   33 (94)
Q Consensus        22 ~~~~~~~R~l~~   33 (94)
                      +++|+++|+.+.
T Consensus        12 ~~Gff~ar~~~~   23 (64)
T PF03672_consen   12 VIGFFIARKYME   23 (64)
T ss_pred             HHHHHHHHHHHH
Confidence            356777765554


No 8  
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=46.78  E-value=21  Score=25.83  Aligned_cols=19  Identities=11%  Similarity=0.239  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHhhhhhhc
Q 048115           14 AAMTFVASMCVFQLTRNVL   32 (94)
Q Consensus        14 ~avgvAvg~~~~~~~R~l~   32 (94)
                      +.+-+++|+++|...||++
T Consensus       126 ~g~ll~i~~giy~~~r~~~  144 (145)
T PF10661_consen  126 GGILLAICGGIYVVLRKVW  144 (145)
T ss_pred             HHHHHHHHHHHHHHHHHhh
Confidence            3344677788899999886


No 9  
>PF13056 DUF3918:  Protein of unknown function (DUF3918)
Probab=40.70  E-value=26  Score=21.09  Aligned_cols=16  Identities=19%  Similarity=0.468  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHhhhh
Q 048115           14 AAMTFVASMCVFQLTR   29 (94)
Q Consensus        14 ~avgvAvg~~~~~~~R   29 (94)
                      .++++++|+++|++.+
T Consensus         7 Slla~GaG~aAy~~A~   22 (43)
T PF13056_consen    7 SLLAFGAGAAAYQMAQ   22 (43)
T ss_pred             HHHHHhHHHHHHHHHH
Confidence            4677888999999873


No 10 
>PRK13755 putative mercury transport protein MerC; Provisional
Probab=40.16  E-value=34  Score=25.19  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=16.9

Q ss_pred             hhhHHHHHHHHHHHHHHhhhhh
Q 048115            9 VYPLMAAMTFVASMCVFQLTRN   30 (94)
Q Consensus         9 vyPL~~avgvAvg~~~~~~~R~   30 (94)
                      ++|||+++....-+.+|+.-|+
T Consensus        53 LlPlFA~iALlanalgW~sHRQ   74 (139)
T PRK13755         53 LLPLFAAIALLANALGWFSHRQ   74 (139)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            5788888888877777777664


No 11 
>PF05751 FixH:  FixH;  InterPro: IPR008620 This family consists of several Rhizobium FixH like proteins. It has been suggested that the four proteins FixG, FixH, FixI, and FixS may participate in a membrane-bound complex coupling the FixI cation pump with a redox process catalysed by FixG [].
Probab=38.86  E-value=8.8  Score=26.14  Aligned_cols=41  Identities=15%  Similarity=0.185  Sum_probs=24.0

Q ss_pred             HHHHHHHHHHHHHHhhhhhhccCCceeeecCCCCCcccch-hHhhhhhhhhh
Q 048115           12 LMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMGVLEN-EEEGEKYAEHG   62 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~R~l~~nP~vRv~K~~R~~gv~en-~~EG~~y~~H~   62 (94)
                      |++.+++.+++|++.++--+.+.+++          +.++ +++|..|.+..
T Consensus         8 ii~~~~~~v~~~~~~v~~A~~~~~~l----------V~~dYY~~g~~y~~~i   49 (146)
T PF05751_consen    8 IIAFFAVFVVANVTMVYIAISTPDGL----------VVDDYYEKGLAYNQDI   49 (146)
T ss_pred             hHHhhhhEeeeeeeEEeeeccCCCCc----------eeccHHHhhhhhhhhh
Confidence            34445555666666666544444433          3345 59999998664


No 12 
>PRK13887 conjugal transfer protein TrbF; Provisional
Probab=37.52  E-value=72  Score=24.43  Aligned_cols=15  Identities=7%  Similarity=0.270  Sum_probs=9.0

Q ss_pred             hhhhhhhhhhHhhhc
Q 048115           55 GEKYAEHGLRRFLRT   69 (94)
Q Consensus        55 G~~y~~H~~Rr~~~~   69 (94)
                      .+.-.+|.+.+|++.
T Consensus       108 ~ea~~~~~L~~fV~~  122 (250)
T PRK13887        108 DPRVIHAAVADFIEN  122 (250)
T ss_pred             CHHHHHHHHHHHHHh
Confidence            344556667667764


No 13 
>PF05961 Chordopox_A13L:  Chordopoxvirus A13L protein;  InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus [].
Probab=36.64  E-value=60  Score=21.35  Aligned_cols=23  Identities=4%  Similarity=0.131  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHhhhhhhccC
Q 048115           12 LMAAMTFVASMCVFQLTRNVLLN   34 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~R~l~~n   34 (94)
                      |++++.+++|+..|.++++-..+
T Consensus         7 Li~ICVaii~lIlY~iYnr~~~~   29 (68)
T PF05961_consen    7 LIIICVAIIGLILYGIYNRKKTT   29 (68)
T ss_pred             HHHHHHHHHHHHHHHHHhccccc
Confidence            56677778889999999865544


No 14 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.44  E-value=23  Score=23.43  Aligned_cols=28  Identities=14%  Similarity=0.299  Sum_probs=14.7

Q ss_pred             ccCcchhhHHHHHHHHHHHHHHhhhhhhccC
Q 048115            4 WMRPEVYPLMAAMTFVASMCVFQLTRNVLLN   34 (94)
Q Consensus         4 Wi~pEvyPL~~avgvAvg~~~~~~~R~l~~n   34 (94)
                      |+--=+++|...+|+++   +|+++|+.+..
T Consensus         4 ~lail~ivl~ll~G~~~---G~fiark~~~k   31 (71)
T COG3763           4 WLAILLIVLALLAGLIG---GFFIARKQMKK   31 (71)
T ss_pred             HHHHHHHHHHHHHHHHH---HHHHHHHHHHH
Confidence            43333344444444443   48888877654


No 15 
>COG3766 Predicted membrane protein [Function unknown]
Probab=36.19  E-value=22  Score=26.10  Aligned_cols=38  Identities=24%  Similarity=0.451  Sum_probs=33.8

Q ss_pred             HHHHHHHHHHHHHHhhhhhhccCCceeeecCCCCCccc
Q 048115           12 LMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMGVL   49 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~R~l~~nP~vRv~K~~R~~gv~   49 (94)
                      ..+++|.++=+.+|+.+|-++.|=+.+++..++++|.+
T Consensus        78 ~Wg~~~~vvqLl~f~i~~~l~p~l~~~I~ngn~AaG~~  115 (133)
T COG3766          78 AWGAIALVVQLLVFFIVRLLMPDLDEKIENGNVAAGFI  115 (133)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCccHHHHhcCcchHHHH
Confidence            46789999999999999999999999999999988854


No 16 
>PF09919 DUF2149:  Uncharacterized conserved protein (DUF2149);  InterPro: IPR018676  This family of conserved hypothetical proteins has no known function. 
Probab=35.64  E-value=39  Score=22.80  Aligned_cols=33  Identities=18%  Similarity=0.179  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHhhhhhhccCCceeeecCCCCC
Q 048115           14 AAMTFVASMCVFQLTRNVLLNPDVRINKGRRSM   46 (94)
Q Consensus        14 ~avgvAvg~~~~~~~R~l~~nP~vRv~K~~R~~   46 (94)
                      +|+|+-+.+......-.++.+.|+.+.|++.+.
T Consensus        14 fav~llvalv~~~n~~~~~s~~~~t~~~~~~~~   46 (92)
T PF09919_consen   14 FAVGLLVALVMSWNMQEVFSDEDVTIVKNPGQP   46 (92)
T ss_pred             HHHHHHHHHHHhcCCccccccccceeeccCCcc
Confidence            344444444333333345578888888776664


No 17 
>PF12454 Ecm33:  GPI-anchored cell wall organization protein
Probab=31.73  E-value=76  Score=18.76  Aligned_cols=32  Identities=16%  Similarity=0.143  Sum_probs=21.6

Q ss_pred             hhhHHHHHHHHHHHHHHhhhhhhccCCceeeecCCCCCc
Q 048115            9 VYPLMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSMG   47 (94)
Q Consensus         9 vyPL~~avgvAvg~~~~~~~R~l~~nP~vRv~K~~R~~g   47 (94)
                      +.|.+++.|.|.+.-       .|...+..|.-|..+++
T Consensus         7 ~lpAlaaag~a~A~s-------~C~~~t~tI~nQ~Da~~   38 (40)
T PF12454_consen    7 LLPALAAAGAAAAAS-------SCSGGTTTIENQADATA   38 (40)
T ss_pred             HHHHHHHHHHHHHhc-------cCCCCceeeeccccchh
Confidence            568888887766542       44566777777776654


No 18 
>PF11084 DUF2621:  Protein of unknown function (DUF2621);  InterPro: IPR020203 This entry represents a group of uncharacterised proteins.
Probab=31.60  E-value=53  Score=24.30  Aligned_cols=33  Identities=15%  Similarity=0.129  Sum_probs=23.2

Q ss_pred             hhHHHHHHHHHHHHHHhhhhhhccCCceeeecCCCCC
Q 048115           10 YPLMAAMTFVASMCVFQLTRNVLLNPDVRINKGRRSM   46 (94)
Q Consensus        10 yPL~~avgvAvg~~~~~~~R~l~~nP~vRv~K~~R~~   46 (94)
                      .--.+++-+.+++++|++.|+++.    |+-|++-.+
T Consensus        11 ~~W~~vli~l~~IGGfFMFRKFLK----~lPKeDGkS   43 (141)
T PF11084_consen   11 LFWVVVLIGLMAIGGFFMFRKFLK----RLPKEDGKS   43 (141)
T ss_pred             HHHHHHHHHHHHHhHHHHHHHHHH----hCCcccCcc
Confidence            334556667789999999999975    455555444


No 19 
>PHA02681 ORF089 virion membrane protein; Provisional
Probab=30.36  E-value=69  Score=22.10  Aligned_cols=29  Identities=21%  Similarity=0.213  Sum_probs=21.2

Q ss_pred             HHHHHHHHHHHHhhhhhhc-cCCceeeecC
Q 048115           14 AAMTFVASMCVFQLTRNVL-LNPDVRINKG   42 (94)
Q Consensus        14 ~avgvAvg~~~~~~~R~l~-~nP~vRv~K~   42 (94)
                      +++-+-+|+..|-+||.-+ +.|+++.+|+
T Consensus        10 ~V~V~IVclliya~YRR~~i~~p~~~r~~D   39 (92)
T PHA02681         10 VIVISIVCYIVIMMYRRSCVSAPAVPRNKD   39 (92)
T ss_pred             HHHHHHHHHHHHHHHHhccCCCCCCCcccc
Confidence            5566678888999999887 5688774443


No 20 
>PF08602 Mgr1:  Mgr1-like, i-AAA protease complex subunit;  InterPro: IPR013911  The Saccharomyces cerevisiae (Baker's yeast) Mgr1 protein has been shown to be required for mitochondrial viability in yeast lacking mitochondrial DNA. It is a mitochondrial inner membrane protein, which interacts with Yme1 and is a new subunit of the i-AAA protease complex [, ]. 
Probab=30.23  E-value=76  Score=26.70  Aligned_cols=17  Identities=12%  Similarity=0.342  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHhhhhhh
Q 048115           15 AMTFVASMCVFQLTRNV   31 (94)
Q Consensus        15 avgvAvg~~~~~~~R~l   31 (94)
                      ++=+++|+.+|.-+|.|
T Consensus        62 ~~Q~~~Gl~~~~r~R~l   78 (363)
T PF08602_consen   62 GLQTAVGLFCFRRARRL   78 (363)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            34467777788888877


No 21 
>PRK11677 hypothetical protein; Provisional
Probab=29.82  E-value=34  Score=24.71  Aligned_cols=22  Identities=18%  Similarity=0.102  Sum_probs=11.3

Q ss_pred             HHHHHHHH-HHHHhhhhhhccCCce
Q 048115           14 AAMTFVAS-MCVFQLTRNVLLNPDV   37 (94)
Q Consensus        14 ~avgvAvg-~~~~~~~R~l~~nP~v   37 (94)
                      +++|+++| +++|++.| + +++.+
T Consensus         6 a~i~livG~iiG~~~~R-~-~~~~~   28 (134)
T PRK11677          6 ALIGLVVGIIIGAVAMR-F-GNRKL   28 (134)
T ss_pred             HHHHHHHHHHHHHHHHh-h-ccchh
Confidence            34444444 45666667 3 45444


No 22 
>PF15114 UPF0640:  Uncharacterised protein family UPF0640
Probab=29.68  E-value=31  Score=22.73  Aligned_cols=12  Identities=17%  Similarity=0.263  Sum_probs=10.3

Q ss_pred             hhhHHHHHHHHH
Q 048115            9 VYPLMAAMTFVA   20 (94)
Q Consensus         9 vyPL~~avgvAv   20 (94)
                      .+|||.++|.|+
T Consensus        26 FLP~FF~lGaal   37 (69)
T PF15114_consen   26 FLPLFFVLGAAL   37 (69)
T ss_pred             hhHHHHHhhhhh
Confidence            479999999876


No 23 
>PF14654 Epiglycanin_C:  Mucin, catalytic, TM and cytoplasmic tail region
Probab=29.20  E-value=50  Score=23.35  Aligned_cols=17  Identities=24%  Similarity=0.169  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHhhhhhhc
Q 048115           16 MTFVASMCVFQLTRNVL   32 (94)
Q Consensus        16 vgvAvg~~~~~~~R~l~   32 (94)
                      ++|.+..+.|+|+|+.+
T Consensus        30 vavGl~aGLfFcvR~~l   46 (106)
T PF14654_consen   30 VAVGLFAGLFFCVRNSL   46 (106)
T ss_pred             HHHHHHHHHHHHhhhcc
Confidence            34445566789999743


No 24 
>PF03650 MPC:  Uncharacterised protein family (UPF0041);  InterPro: IPR005336 This is a family of proteins of unknown function.
Probab=28.86  E-value=62  Score=23.17  Aligned_cols=30  Identities=30%  Similarity=0.446  Sum_probs=26.5

Q ss_pred             cCcchhhHHHHHHHHHHHHHHhhhhhhccC
Q 048115            5 MRPEVYPLMAAMTFVASMCVFQLTRNVLLN   34 (94)
Q Consensus         5 i~pEvyPL~~avgvAvg~~~~~~~R~l~~n   34 (94)
                      |.|.=|.||++=.+-.+..++|++|.+.++
T Consensus        67 I~P~Ny~L~a~n~~~~~~q~~Ql~R~~~y~   96 (119)
T PF03650_consen   67 ITPRNYLLFACNFFNATTQLYQLYRKLNYQ   96 (119)
T ss_pred             ecCchHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            578889999999888999999999988766


No 25 
>PF06295 DUF1043:  Protein of unknown function (DUF1043);  InterPro: IPR009386 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=28.30  E-value=30  Score=24.18  Aligned_cols=15  Identities=20%  Similarity=0.372  Sum_probs=6.9

Q ss_pred             HHHHHHHH-HHHhhhh
Q 048115           15 AMTFVASM-CVFQLTR   29 (94)
Q Consensus        15 avgvAvg~-~~~~~~R   29 (94)
                      ++|+++|+ ++|.+.|
T Consensus         3 ~i~lvvG~iiG~~~~r   18 (128)
T PF06295_consen    3 IIGLVVGLIIGFLIGR   18 (128)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            33444433 4455555


No 26 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=28.26  E-value=75  Score=21.50  Aligned_cols=18  Identities=11%  Similarity=0.056  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHhhhh
Q 048115           12 LMAAMTFVASMCVFQLTR   29 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~R   29 (94)
                      +.++.|+.+++|+|-.++
T Consensus         7 v~~~~~v~~~i~~y~~~k   24 (87)
T PF10883_consen    7 VGGVGAVVALILAYLWWK   24 (87)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            457778888888887775


No 27 
>PF09849 DUF2076:  Uncharacterized protein conserved in bacteria (DUF2076);  InterPro: IPR018648  This family of hypothetical prokaryotic proteins has no known function but includes putative perimplasmic ligand-binding sensor proteins.
Probab=27.80  E-value=63  Score=25.46  Aligned_cols=23  Identities=9%  Similarity=-0.009  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHhhhhhhccC
Q 048115           12 LMAAMTFVASMCVFQLTRNVLLN   34 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~R~l~~n   34 (94)
                      |-.|.|||.|+..+..+++|+.+
T Consensus       142 ~~TAAGVAGG~lL~n~i~~lF~~  164 (247)
T PF09849_consen  142 AQTAAGVAGGMLLANGIESLFGG  164 (247)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcC
Confidence            45689999999999999999987


No 28 
>PF11833 DUF3353:  Protein of unknown function (DUF3353);  InterPro: IPR021788  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 205 to 258 amino acids in length. 
Probab=26.81  E-value=56  Score=24.65  Aligned_cols=15  Identities=20%  Similarity=0.616  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHhhhhh
Q 048115           16 MTFVASMCVFQLTRN   30 (94)
Q Consensus        16 vgvAvg~~~~~~~R~   30 (94)
                      ++++++.|+|++.|+
T Consensus       121 Lal~~~~~iyfl~~K  135 (194)
T PF11833_consen  121 LALGLGACIYFLNRK  135 (194)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            567778999999996


No 29 
>PF08114 PMP1_2:  ATPase proteolipid family;  InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase. Two proteolipids (PMP1 and PMP2) are associated with the ATPase and both genes are similarly expressed in the wild-type strain of yeast. No modification of the level of transcription of one PMP gene is detected in a strain deleted of the other. Though both proteolipids show similarity with other small proteolipids associated with other cation -transporting ATPases, their functions remain unclear [].
Probab=26.79  E-value=64  Score=19.50  Aligned_cols=27  Identities=7%  Similarity=0.037  Sum_probs=17.4

Q ss_pred             CcchhhHHHHHHH-HHHHHHHhhhhhhc
Q 048115            6 RPEVYPLMAAMTF-VASMCVFQLTRNVL   32 (94)
Q Consensus         6 ~pEvyPL~~avgv-Avg~~~~~~~R~l~   32 (94)
                      |-.|+=.|+.||+ ++++.+.+.+||..
T Consensus         7 p~GVIlVF~lVglv~i~iva~~iYRKw~   34 (43)
T PF08114_consen    7 PGGVILVFCLVGLVGIGIVALFIYRKWQ   34 (43)
T ss_pred             CCCeeeehHHHHHHHHHHHHHHHHHHHH
Confidence            3345555666664 46777888888764


No 30 
>PF11346 DUF3149:  Protein of unknown function (DUF3149);  InterPro: IPR021494  This bacterial family of proteins has no known function. 
Probab=26.21  E-value=1e+02  Score=18.27  Aligned_cols=21  Identities=24%  Similarity=0.392  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHh---hhhhhccCC
Q 048115           15 AMTFVASMCVFQ---LTRNVLLNP   35 (94)
Q Consensus        15 avgvAvg~~~~~---~~R~l~~nP   35 (94)
                      ++.+++|+++|+   ..||...|+
T Consensus        18 vI~~~igm~~~~~~~F~~k~~~~~   41 (42)
T PF11346_consen   18 VIVFTIGMGVFFIRYFIRKMKEDE   41 (42)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcccC
Confidence            344455555554   346666654


No 31 
>PF06450 NhaB:  Bacterial Na+/H+ antiporter B (NhaB);  InterPro: IPR004671 The Escherichia coli NhaB Na+:H+ Antiporter (NhaB) protein has 12 predicted TMS, and catalyses sodium/proton exchange. Unlike NhaA, IPR004670 from INTERPRO, this activity is not pH dependent.; GO: 0015385 sodium:hydrogen antiporter activity, 0006814 sodium ion transport, 0016021 integral to membrane
Probab=25.83  E-value=26  Score=30.46  Aligned_cols=50  Identities=14%  Similarity=0.215  Sum_probs=28.6

Q ss_pred             HHHHHHHHHhhhhhhccCCceeeecCCCCCcccchhHhhhhhhhhhhhHhhhc
Q 048115           17 TFVASMCVFQLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHGLRRFLRT   69 (94)
Q Consensus        17 gvAvg~~~~~~~R~l~~nP~vRv~K~~R~~gv~en~~EG~~y~~H~~Rr~~~~   69 (94)
                      -.+|+.+-|+.|++..++.+..=+.+...+.   ..+|..+=.-..+|-|+|+
T Consensus       155 iIsVa~GFY~iYHkvaSg~~~~~~~d~~~D~---~v~~~~r~~Le~FRaFLRs  204 (515)
T PF06450_consen  155 IISVAVGFYSIYHKVASGKDFHDDHDHTDDS---KVDELNREDLEQFRAFLRS  204 (515)
T ss_pred             eeEeeehhhhhhhhhhcCCCCCCccCCccch---hhhhhhHHHHHHHHHHHHH
Confidence            3455667899999999998875332222221   1222222222356888887


No 32 
>PF14962 AIF-MLS:  Mitochondria Localisation Sequence; PDB: 1M6I_A.
Probab=25.48  E-value=23  Score=27.01  Aligned_cols=27  Identities=7%  Similarity=-0.026  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHHHhhhhhhccCCc
Q 048115           10 YPLMAAMTFVASMCVFQLTRNVLLNPD   36 (94)
Q Consensus        10 yPL~~avgvAvg~~~~~~~R~l~~nP~   36 (94)
                      .-+++.||+.+..++|+.||-|..|..
T Consensus        46 ~~Y~l~vG~t~~gag~YaYkTv~~dq~   72 (180)
T PF14962_consen   46 MVYYLVVGVTVSGAGYYAYKTVKSDQA   72 (180)
T ss_dssp             ---------------------------
T ss_pred             EEEEEEECeEEEeeEEEEEEeecchhH
Confidence            346788999999999999997776643


No 33 
>PF11654 DUF2665:  Protein of unknown function (DUF2665);  InterPro: IPR024242 This entry represents the non classical export protein 1 family. Family members are Involved in a novel pathway of export of proteins that lack a cleavable signal sequence [].; GO: 0009306 protein secretion
Probab=25.43  E-value=72  Score=19.48  Aligned_cols=16  Identities=13%  Similarity=0.212  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHhhhhh
Q 048115           15 AMTFVASMCVFQLTRN   30 (94)
Q Consensus        15 avgvAvg~~~~~~~R~   30 (94)
                      .+|+++|.++|+++-+
T Consensus        10 ~~av~iG~~ayyl~e~   25 (47)
T PF11654_consen   10 LFAVFIGTSAYYLYEN   25 (47)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3567788899998864


No 34 
>PF12286 DUF3622:  Protein of unknown function (DUF3622);  InterPro: IPR022069  This family of proteins is found in bacteria. Proteins in this family are typically between 72 and 107 amino acids in length. There is a conserved VSK sequence motif. 
Probab=25.23  E-value=58  Score=21.57  Aligned_cols=41  Identities=29%  Similarity=0.467  Sum_probs=29.0

Q ss_pred             hhhhhhccCCceeeecCCCCCcccchhHhhhhhhhhhhhHhhhcC
Q 048115           26 QLTRNVLLNPDVRINKGRRSMGVLENEEEGEKYAEHGLRRFLRTR   70 (94)
Q Consensus        26 ~~~R~l~~nP~vRv~K~~R~~gv~en~~EG~~y~~H~~Rr~~~~~   70 (94)
                      -++|+++....|.-.   |+.|.. ..+|++.|.++-|.-||.++
T Consensus        21 EItR~vTsrkTvVSK---~~~GF~-SEaeAq~W~e~eL~~fl~n~   61 (71)
T PF12286_consen   21 EITRRVTSRKTVVSK---RQDGFA-SEAEAQAWGEKELKSFLENQ   61 (71)
T ss_pred             eeeeeecCceeEEEe---cccCcc-cHHHHHHHHHHHHHHHHHHH
Confidence            456777776665432   445533 57999999999999999763


No 35 
>PF12732 YtxH:  YtxH-like protein;  InterPro: IPR024623 This family of uncharacterised proteins is found in bacteria. Proteins in this family are typically between 100 and 143 amino acids in length. The N-terminal region is the most conserved.
Probab=24.97  E-value=82  Score=19.60  Aligned_cols=16  Identities=19%  Similarity=-0.145  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHHHhh
Q 048115           12 LMAAMTFVASMCVFQL   27 (94)
Q Consensus        12 L~~avgvAvg~~~~~~   27 (94)
                      +.+++|+++|.++-.+
T Consensus         3 ~g~l~Ga~~Ga~~glL   18 (74)
T PF12732_consen    3 LGFLAGAAAGAAAGLL   18 (74)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4566777777766655


No 36 
>PF15050 SCIMP:  SCIMP protein
Probab=24.95  E-value=1.2e+02  Score=22.33  Aligned_cols=64  Identities=16%  Similarity=0.345  Sum_probs=35.1

Q ss_pred             ccCcchhhHHHHHHHHHHHHHHhhhh-hhccCCceeeecCCCCCcccchhHhhhhhhhhhhhHhhhcCCCCcccccc
Q 048115            4 WMRPEVYPLMAAMTFVASMCVFQLTR-NVLLNPDVRINKGRRSMGVLENEEEGEKYAEHGLRRFLRTRPPQVMPAIN   79 (94)
Q Consensus         4 Wi~pEvyPL~~avgvAvg~~~~~~~R-~l~~nP~vRv~K~~R~~gv~en~~EG~~y~~H~~Rr~~~~~~p~imp~~n   79 (94)
                      ||--.|-  ++.|++.+|+..|-..| +|.....-.+.|--++.+    -+|.+.|. +     +-+++|--.|.|+
T Consensus         9 WiiLAVa--II~vS~~lglIlyCvcR~~lRqGkkweiakp~k~~~----rdeEkmYE-N-----v~n~~~~~LPpLP   73 (133)
T PF15050_consen    9 WIILAVA--IILVSVVLGLILYCVCRWQLRQGKKWEIAKPLKQKQ----RDEEKMYE-N-----VLNQSPVQLPPLP   73 (133)
T ss_pred             HHHHHHH--HHHHHHHHHHHHHHHHHHHHHccccceeccchhhhc----ccHHHHHH-H-----hhcCCcCCCCCCC
Confidence            4433333  45667777777776554 455555555555444432    34555554 3     4566665555553


No 37 
>COG3592 Uncharacterized conserved protein [Function unknown]
Probab=24.89  E-value=33  Score=22.90  Aligned_cols=10  Identities=40%  Similarity=0.680  Sum_probs=8.5

Q ss_pred             hcCCCCcccc
Q 048115           68 RTRPPQVMPA   77 (94)
Q Consensus        68 ~~~~p~imp~   77 (94)
                      .+++|+|||.
T Consensus        41 ~~rkPWI~Pd   50 (74)
T COG3592          41 LGRKPWIMPD   50 (74)
T ss_pred             cCCCCccCCC
Confidence            5689999996


No 38 
>PF04550 Phage_holin_2:  Phage holin family 2 ;  InterPro: IPR007633 This entry represents the Bacteriophage P2, GpY, holin protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This protein family represent one of a large number of mutually dissimilar families of phage holins. It is thought that the temporal precision of holin-mediated lysis may occur through the build-up of a holin oligomer which causes the lysis [].
Probab=24.39  E-value=80  Score=21.70  Aligned_cols=23  Identities=17%  Similarity=0.356  Sum_probs=16.9

Q ss_pred             cchhhHH-HHHHHHHHHHHHhhhh
Q 048115            7 PEVYPLM-AAMTFVASMCVFQLTR   29 (94)
Q Consensus         7 pEvyPL~-~avgvAvg~~~~~~~R   29 (94)
                      |++=|+. +.+|.|+|+++||.+-
T Consensus        57 Pdl~plAv~GlgsalGI~G~q~vE   80 (89)
T PF04550_consen   57 PDLPPLAVIGLGSALGIAGYQAVE   80 (89)
T ss_pred             CCCCHHHHHHHHHHHHhhhHHHHH
Confidence            5665654 4578899999998763


No 39 
>KOG2802 consensus Membrane protein HUEL (cation efflux superfamily) [General function prediction only]
Probab=24.08  E-value=67  Score=27.87  Aligned_cols=22  Identities=18%  Similarity=0.276  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHhhhhhhccCC
Q 048115           13 MAAMTFVASMCVFQLTRNVLLNP   35 (94)
Q Consensus        13 ~~avgvAvg~~~~~~~R~l~~nP   35 (94)
                      .++.||++++|+..+++ ++.||
T Consensus       368 AAVtGv~IAaa~m~lss-~tgnP  389 (503)
T KOG2802|consen  368 AAVTGVIIAAACMGLSS-ITGNP  389 (503)
T ss_pred             HHHHHHHHHHHHHHHHH-hcCCC
Confidence            47789999999999998 77777


No 40 
>PF08009 CDP-OH_P_tran_2:  CDP-alcohol phosphatidyltransferase 2;  InterPro: IPR012616  This domain is found on CDP-alcohol phosphatidyltransferases. These enzymes catalyse the displacement of CMP from a CDP-alcohol by a second alcohol with formation of a phosphodiester bond and concomitant breaking of a phosphoride anhydride bond. 
Probab=24.07  E-value=86  Score=18.26  Aligned_cols=14  Identities=29%  Similarity=0.543  Sum_probs=9.8

Q ss_pred             hhhHHHHHHHHHHH
Q 048115            9 VYPLMAAMTFVASM   22 (94)
Q Consensus         9 vyPL~~avgvAvg~   22 (94)
                      ++|+++.+|+.+++
T Consensus         5 vlpl~~~v~l~~a~   18 (39)
T PF08009_consen    5 VLPLILLVGLYAAL   18 (39)
T ss_pred             ehHHHHHHHHHHHH
Confidence            68888777765544


No 41 
>PF13400 Tad:  Putative Flp pilus-assembly TadE/G-like
Probab=23.45  E-value=1.3e+02  Score=17.19  Aligned_cols=21  Identities=19%  Similarity=0.300  Sum_probs=13.0

Q ss_pred             hhhHHHHHHHHHHHHHHhhhh
Q 048115            9 VYPLMAAMTFVASMCVFQLTR   29 (94)
Q Consensus         9 vyPL~~avgvAvg~~~~~~~R   29 (94)
                      +.|+++.+|+++-..-....|
T Consensus        11 ~~~~l~~~~~~id~~~~~~~r   31 (48)
T PF13400_consen   11 LVPLLLLIGLAIDVGRAYLAR   31 (48)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            356666777766665555554


No 42 
>PRK11089 PTS system glucose-specific transporter subunits  IIBC; Provisional
Probab=22.78  E-value=56  Score=27.93  Aligned_cols=14  Identities=21%  Similarity=0.380  Sum_probs=12.5

Q ss_pred             hhHHHHHHHHHHHH
Q 048115           10 YPLMAAMTFVASMC   23 (94)
Q Consensus        10 yPL~~avgvAvg~~   23 (94)
                      .||+.|||+|+|++
T Consensus        59 LpllFavgia~g~a   72 (477)
T PRK11089         59 MPLIFAIGVALGFT   72 (477)
T ss_pred             cHHHHHHHHHHHHh
Confidence            69999999999877


No 43 
>PF14990 DUF4516:  Domain of unknown function (DUF4516)
Probab=22.60  E-value=1.1e+02  Score=18.59  Aligned_cols=30  Identities=13%  Similarity=0.267  Sum_probs=18.8

Q ss_pred             hhHHHHHHHHHHHHHHhhhhhhccCCceeee
Q 048115           10 YPLMAAMTFVASMCVFQLTRNVLLNPDVRIN   40 (94)
Q Consensus        10 yPL~~avgvAvg~~~~~~~R~l~~nP~vRv~   40 (94)
                      |-.++++.++.-+++-++++ ...-||+.+-
T Consensus        10 yl~~~~~s~~sM~aGA~vVH-~~ykPdltiP   39 (47)
T PF14990_consen   10 YLKSLVASLLSMLAGASVVH-NIYKPDLTIP   39 (47)
T ss_pred             HHHHHHHHHHHHHhhhHHHH-HHhCccCCCC
Confidence            44555555555555666665 6678888763


No 44 
>TIGR02005 PTS-IIBC-alpha PTS system, alpha-glucoside-specific IIBC component. This model represents a family of fused PTS enzyme II B and C domains. A gene from Clostridium has been partially characterized as a maltose transporter, while genes from Fusobacterium and Klebsiella have been proposed to transport the five non-standard isomers of sucrose.
Probab=21.64  E-value=57  Score=28.22  Aligned_cols=14  Identities=14%  Similarity=0.365  Sum_probs=12.1

Q ss_pred             hhHHHHHHHHHHHH
Q 048115           10 YPLMAAMTFVASMC   23 (94)
Q Consensus        10 yPL~~avgvAvg~~   23 (94)
                      +||+.|||+|+|++
T Consensus        65 LpllFAvgia~Gla   78 (524)
T TIGR02005        65 MPLIFVVGLPIGLA   78 (524)
T ss_pred             chHHHHHHHHHHhc
Confidence            79999999998765


No 45 
>PF10177 DUF2371:  Uncharacterised conserved protein (DUF2371);  InterPro: IPR018787  This family of proteins with no known function is conserved from nematodes to humans. It includes members of the TMEM200 family of transmembrane proteins. 
Probab=21.55  E-value=31  Score=25.25  Aligned_cols=17  Identities=6%  Similarity=0.045  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHhhh
Q 048115           12 LMAAMTFVASMCVFQLT   28 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~   28 (94)
                      |.+.+|+|++.++|.-.
T Consensus        48 lvllvGiaMAv~GYwp~   64 (141)
T PF10177_consen   48 LVLLVGIAMAVLGYWPK   64 (141)
T ss_pred             HHHHHhhHhheeecccc
Confidence            45667777777787665


No 46 
>PF14155 DUF4307:  Domain of unknown function (DUF4307)
Probab=21.41  E-value=1.1e+02  Score=20.98  Aligned_cols=24  Identities=4%  Similarity=-0.075  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHHHHhhhhhhccCC
Q 048115           12 LMAAMTFVASMCVFQLTRNVLLNP   35 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~R~l~~nP   35 (94)
                      +.+++.+++++.+|+.+.++...|
T Consensus        10 ~~v~~vv~~~~~~w~~~~~~~~~~   33 (112)
T PF14155_consen   10 GAVLVVVAGAVVAWFGYSQFGSPP   33 (112)
T ss_pred             HHHHHHHHHHHHhHhhhhhccCCC
Confidence            455566667777888887665443


No 47 
>KOG3491 consensus Predicted membrane protein [Function unknown]
Probab=21.23  E-value=93  Score=20.22  Aligned_cols=21  Identities=24%  Similarity=0.281  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHhhhhhhc
Q 048115           12 LMAAMTFVASMCVFQLTRNVL   32 (94)
Q Consensus        12 L~~avgvAvg~~~~~~~R~l~   32 (94)
                      |...|=|+.|++.|+.+|...
T Consensus        42 lglFvFVVcGSa~FqIIr~~~   62 (65)
T KOG3491|consen   42 LGLFVFVVCGSALFQIIRTAT   62 (65)
T ss_pred             HHHHHHHhhcHHHHHHHHHHh
Confidence            344455678899999999654


No 48 
>PF10828 DUF2570:  Protein of unknown function (DUF2570);  InterPro: IPR022538 This entry is represented by Bacteriophage IME08, pseT.3. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  This is a family of proteins with unknown function. 
Probab=20.86  E-value=1.2e+02  Score=20.55  Aligned_cols=19  Identities=16%  Similarity=0.172  Sum_probs=11.0

Q ss_pred             hhHHHHHHHHHHHHHHhhh
Q 048115           10 YPLMAAMTFVASMCVFQLT   28 (94)
Q Consensus        10 yPL~~avgvAvg~~~~~~~   28 (94)
                      |...++.-+++|+|+|..+
T Consensus         4 ~~~~~l~~lvl~L~~~l~~   22 (110)
T PF10828_consen    4 YIYIALAVLVLGLGGWLWY   22 (110)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3445555556667766554


No 49 
>TIGR02003 PTS-II-BC-unk1 PTS system, IIBC component. This model represents a family of fused B and C components of PTS enzyme II. This clade is a member of a larger family which contains enzyme II's specific for a variety of sugars including glucose (TIGR02002) and N-acetylglucosamine (TIGR01998). None of the members of this clade have been experimentally characterized. This clade includes sequences from Streptococcus and Enterococcus which also include a C-terminal A domain as well as Bacillus and Clostridium which do not. In nearly all cases, these species also contain an authentic glucose-specific PTS transporter.
Probab=20.54  E-value=67  Score=28.01  Aligned_cols=14  Identities=14%  Similarity=0.190  Sum_probs=12.4

Q ss_pred             hhHHHHHHHHHHHH
Q 048115           10 YPLMAAMTFVASMC   23 (94)
Q Consensus        10 yPL~~avgvAvg~~   23 (94)
                      .||+.|||+|+|++
T Consensus        63 LpllFAigiaiGla   76 (548)
T TIGR02003        63 LHILFALAIGGSWA   76 (548)
T ss_pred             chHHHHHHHHHHHh
Confidence            79999999999876


No 50 
>PF10269 Tmemb_185A:  Transmembrane Fragile-X-F protein ;  InterPro: IPR019396  This entry represents conserved transmembrane proteins that in humans are expressed from a region upstream of the FragileXF site and appear to be intimately linked with Fragile-X syndrome. The absence of the human TMEM185A protein does not necessarily lead to developmental delay, but might, in combination with other, currently unknown, factors. Alternatively, the TMEM185A protein is either redundant, or its function can be complemented by the highly similar chromosome 2 retro-pseudogene product, TMEM185B []. 
Probab=20.23  E-value=72  Score=24.28  Aligned_cols=22  Identities=18%  Similarity=0.452  Sum_probs=19.1

Q ss_pred             hhHHHHHHHHHHHHHHhhhhhh
Q 048115           10 YPLMAAMTFVASMCVFQLTRNV   31 (94)
Q Consensus        10 yPL~~avgvAvg~~~~~~~R~l   31 (94)
                      .||+++.|.++..|.+.+.+.+
T Consensus       151 iPl~i~~~~~~~~~~~~~i~~~  172 (238)
T PF10269_consen  151 IPLWIADGLAFLVCLYSIIMSI  172 (238)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            7999999999999988877754


No 51 
>PF14898 DUF4491:  Domain of unknown function (DUF4491)
Probab=20.19  E-value=1.2e+02  Score=21.09  Aligned_cols=21  Identities=5%  Similarity=0.317  Sum_probs=16.7

Q ss_pred             chhhHHHHHHHHHHHHHHhhh
Q 048115            8 EVYPLMAAMTFVASMCVFQLT   28 (94)
Q Consensus         8 EvyPL~~avgvAvg~~~~~~~   28 (94)
                      -.+|+|.++|.+..+++.++.
T Consensus        33 ~~W~~FL~~Gi~~~~~Sl~~~   53 (94)
T PF14898_consen   33 RIWPIFLLAGIACIIASLFVS   53 (94)
T ss_pred             CcHHHHHHHHHHHHHHHHHHc
Confidence            468999999998888776654


No 52 
>PLN02949 transferase, transferring glycosyl groups
Probab=20.14  E-value=1e+02  Score=25.65  Aligned_cols=39  Identities=13%  Similarity=0.313  Sum_probs=25.2

Q ss_pred             CCccCcchhhHHHHHHHHHHHHHH--hhhhhhccCCceeeecC
Q 048115            2 GRWMRPEVYPLMAAMTFVASMCVF--QLTRNVLLNPDVRINKG   42 (94)
Q Consensus         2 ~rWi~pEvyPL~~avgvAvg~~~~--~~~R~l~~nP~vRv~K~   42 (94)
                      +.|+++..||-|-.+|-++|+...  ...++  .-|+|-++--
T Consensus       107 ~~~~~~~~~~~~t~~~~~~~~~~l~~~~~~~--~~p~v~vDt~  147 (463)
T PLN02949        107 RKWIEEETYPRFTMIGQSLGSVYLAWEALCK--FTPLYFFDTS  147 (463)
T ss_pred             ccccccccCCceehHHHHHHHHHHHHHHHHh--cCCCEEEeCC
Confidence            579999999998877777765433  22232  2456666444


Done!