Citrus Sinensis ID: 048121

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MKNFIKVWLSVTISLCYCHAIGKMVSKGIKRLSCLIPVVCLFLYLPLCLTSVHIGGTTAFFITWLANFKLLLFAFGLGPLSSHPPISLPLFVIVSCLPIKIQNNNNPIPGAREGRLNYTIKGLLVAILVQLQLAYEYSDYILSVHPKLILLVYSLHMYFLLELILAASAAVARAMLGLELEPQFKKPHLSTSLQDFWGKRWNLMVTGILRPTVYKPSLHVFTRLTGR
ccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccCEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccc
*KNFIKVWLSVTISLCYCHAIGKMVSKGIKRLSCLIPVVCLFLYLPLCLTSVHIGGTTAFFITWLANFKLLLFAFGLGPLSSHPPISLPLFVIVSCLPIKIQNNNN***GAREGRLNYTIKGLLVAILVQLQLAYEYSDYILSVHPKLILLVYSLHMYFLLELILAASAAVARAMLGLELEPQFKKPHLSTSLQDFWGKRWNLMVTGILRPTVYKPSLHVFTRLTGR
xxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNFIKVWLSVTISLCYCHAIGKMVSKGIKRLSCLIPVVCLFLYLPLCLTSVHIGGTTAFFITWLANFKLLLFAFGLGPLSSHPPISLPLFVIVSCLPIKIQNNNNPIPGAREGRLNYTIKGLLVAILVQLQLAYEYSDYILSVHPKLILLVYSLHMYFLLELILAASAAVARAMLGLELEPQFKKPHLSTSLQDFWGKRWNLMVTGILRPTVYKPSLHVFTRLTGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-CoA--sterol O-acyltransferase 1 Involved in the esterification of cycloartenol. Not implicated in the formation of sterol esters in flowers or during seed maturation. Has a substrate preference toward saturated fatty acyl donors (16:0 > 18:0 > 16:1 > 18:1). Does not require triacyglycerols (TAGs) as a fatty acyl donor, and is unable to acylate diacylglycerol to produce TAG.probableQ9SV07

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted