Citrus Sinensis ID: 048137

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--

MGMLMDGIIEGMPVFAKELVAGGVAGGFGKTAVAPLERVKILFQTRRAEFHSIGLFGSIKKIAKTEGAMGFYRGNGASVARIVPYAALHYMAYEEYRRWIILSFPDVSRGPVLDLIAGSFAGGTAVLFTYPLDLVRTKLAYQIVDSSKKNFQGVVSAEHVYRGIRDCFRQTYKESGLRGLYRGAAPSLYGIFPYAGLKFYFYEEMKRHVPEDHKKDIMVKLACGSIAGLLGQTFTYPLDVVRRQMQVERFSASNSAESRGTMQTLVMIAQKQGWKQLFSGLSINYLKVVPSVAIGFTVYDIMKSYLRVPARDEDVVDVVTNKRNSQPSLHSS

cccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHccccEEcccccccHHHcccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccEEEccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHcHHHHcccccccccccccccEEHHHHHHHHHHHcccccccccccHHHHcccccccccccc

*************VFAKELVAGGVAGGFGKTAVAPLERVKILFQTRRAEFHSIGLFGSIKKIAKTEGAMGFYRGNGASVARIVPYAALHYMAYEEYRRWIILSFPDVSRGPVLDLIAGSFAGGTAVLFTYPLDLVRTKLAYQIVDSS********SAEHVYRGIRDCFRQTYKESGLRGLYRGAAPSLYGIFPYAGLKFYFYEEMKRHVPEDHKKDIMVKLACGSIAGLLGQTFTYPLDVVRRQMQV***********RGTMQTLVMIAQKQGWKQLFSGLSINYLKVVPSVAIGFTVYDIMKSYLRVPARDEDVVDVV*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Graves disease carrier protein	Required for the accumulation of coenzyme A in the mitochondrial matrix.	probable	P16260
Graves disease carrier protein	Required for the accumulation of coenzyme A in the mitochondrial matrix.	probable	Q01888
Graves disease carrier protein homolog	Required for the accumulation of coenzyme A in the mitochondrial matrix.	probable	Q8C0K5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 12-302
View the alignment between query and template
View the model in PyMOL