Citrus Sinensis ID: 048138

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
IKPLSVTYGLGISDHDSEGRLVTAEFDSFFLLSCYVPNSGDGLRRLSYRITEWDPSLSSYVKELEKKKPVILTGDLNCAHQEIDIYNPAGNRRSAGFTDEERQSFGANFLSKGFVDTFRAQHRGVVGYTYWGYRHGGRKTNRGWRLDYFLVSQSLADKFHDSYILPDVTGSDHSPIGLILKL
ccccEEEcccccccccccccEEEEEcccEEEEEEECcccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccCEEEEcccHHHHHHHHHccccccccccccccEEEEECc
IKPLSVTYGLGISDHDSEGRLVTAEFDSFFLLSCYVPNSGDGLRRLSYRITEWDPSLSSYVKELEKKKPVILTGDLNCAHQEIDIYNPAGNRRSAGFTDEERQSFGANFLSKGFVDTFRAQHRGVVGYTYWGYRHGGRKTNRGWRLDYFLVSQSLADKFHDSYILPDVTGSDHSPIGLILKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IKPLSVTYGLGISDHDSEGRLVTAEFDSFFLLSCYVPNSGDGLRRLSYRITEWDPSLSSYVKELEKKKPVILTGDLNCAHQEIDIYNPAGNRRSAGFTDEERQSFGANFLSKGFVDTFRAQHRGVVGYTYWGYRHGGRKTNRGWRLDYFLVSQSLADKFHDSYILPDVTGSDHSPIGLILKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Exodeoxyribonuclease In addition to 3'- to 5'-exonuclease and 3'-phosphatase activities, ExoA was shown to make single-strand breaks at apurinic sites in DNA.probableP0A2X4
Exodeoxyribonuclease In addition to 3'- to 5'-exonuclease and 3'-phosphatase activities, ExoA was shown to make single-strand breaks at apurinic sites in DNA.probableP0A2X3
Apurinic endonuclease-redox protein Repairs oxidative DNA damages, seems also to act as a redox factor. Is multifunctional and may be involved both in DNA repair and in the regulation of transcription.probableP45951

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G91, chain A
Confidence level:very confident
Coverage over the Query: 3-181
View the alignment between query and template
View the model in PyMOL