BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048232
         (455 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2BF6|A Chain A, Atomic Resolution Structure Of The Bacterial Sialidase
           Nani From Clostridium Perfringens In Complex With
           Alpha-Sialic Acid (Neu5ac)
          Length = 449

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 23  SVLFLNSNVGSHSNE--RIFLSSSNSVTEKVWPKLEFSWRIVLATVIGFLGSAC 74
           +V+F N N  S SN   RI L +     E   PK EF W+       G+   +C
Sbjct: 362 AVIFSNPNARSRSNGTVRIGLINQVGTYENGEPKYEFDWKYNKLVKPGYYAYSC 415


>pdb|2VK5|A Chain A, The Structure Of Clostridium Perfringens Nani Sialidase
           And Its Catalytic Intermediates
 pdb|2VK6|A Chain A, The Structure Of Clostridium Perfringens Nani Sialidase
           And Its Catalytic Intermediates
 pdb|2VK7|A Chain A, The Structure Of Clostridium Perfringens Nani Sialidase
           And Its Catalytic Intermediates
 pdb|2VK7|B Chain B, The Structure Of Clostridium Perfringens Nani Sialidase
           And Its Catalytic Intermediates
          Length = 452

 Score = 28.9 bits (63), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 23  SVLFLNSNVGSHSNE--RIFLSSSNSVTEKVWPKLEFSWRIVLATVIGFLGSAC 74
           +V+F N N  S SN   RI L +     E   PK EF W+       G+   +C
Sbjct: 362 AVIFSNPNARSRSNGTVRIGLINQVGTYENGEPKYEFDWKYNKLVKPGYYAYSC 415


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.140    0.433 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,522,136
Number of Sequences: 62578
Number of extensions: 366179
Number of successful extensions: 1103
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1103
Number of HSP's gapped (non-prelim): 3
length of query: 455
length of database: 14,973,337
effective HSP length: 102
effective length of query: 353
effective length of database: 8,590,381
effective search space: 3032404493
effective search space used: 3032404493
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (25.0 bits)