Query         048251
Match_columns 84
No_of_seqs    119 out of 732
Neff          4.4 
Searched_HMMs 46136
Date          Fri Mar 29 07:47:17 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048251.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048251hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03220 uncharacterized prote 100.0 1.3E-29 2.7E-34  172.2   7.9   78    1-80      1-102 (105)
  2 PLN03090 auxin-responsive fami 100.0 1.6E-29 3.4E-34  171.4   7.0   78    1-81      1-103 (104)
  3 PLN03219 uncharacterized prote  99.9 3.6E-27 7.7E-32  160.9   6.5   78    1-80      1-104 (108)
  4 PF02519 Auxin_inducible:  Auxi  99.9 1.4E-25 3.1E-30  149.9   7.1   79    1-82      1-100 (100)
  5 PRK02899 adaptor protein; Prov  86.2    0.62 1.3E-05   34.2   2.4   25   40-67     38-62  (197)
  6 PRK02315 adaptor protein; Prov  79.5     1.4   3E-05   33.0   2.0   25   40-67     38-62  (233)
  7 PF05419 GUN4:  GUN4-like ;  In  76.2       1 2.3E-05   31.4   0.5   18   27-44    109-132 (132)
  8 PF05389 MecA:  Negative regula  75.7    0.88 1.9E-05   33.2   0.0   25   40-67     38-62  (220)
  9 PF11834 DUF3354:  Domain of un  50.0      15 0.00032   23.1   2.0   16   42-57     27-42  (69)
 10 PF02209 VHP:  Villin headpiece  47.5      10 0.00022   21.2   0.9   19   37-55      1-19  (36)
 11 PF02100 ODC_AZ:  Ornithine dec  43.2      19 0.00041   24.1   1.8   46   29-79     30-75  (108)
 12 smart00153 VHP Villin headpiec  42.1      15 0.00031   20.5   1.0   19   37-55      1-19  (36)
 13 PF12058 DUF3539:  Protein of u  38.2     6.9 0.00015   26.2  -0.9   11   36-46      4-14  (88)
 14 PF09781 NDUF_B5:  NADH:ubiquin  36.5      25 0.00055   26.3   1.8   24   24-47     94-120 (187)
 15 PF07425 Pardaxin:  Pardaxin;    33.2      13 0.00027   20.6  -0.2   19   36-54      8-26  (33)
 16 PF08861 DUF1828:  Domain of un  30.2 1.4E+02  0.0031   18.6   4.3   39   40-80     44-82  (90)
 17 COG3769 Predicted hydrolase (H  26.2      50  0.0011   26.0   1.9   30   28-57     76-120 (274)
 18 KOG1748 Acyl carrier protein/N  26.0      44 0.00095   23.7   1.5   49   28-81     73-127 (131)
 19 PF12518 DUF3721:  Protein of u  25.3      50  0.0011   18.4   1.3   23   48-71      8-31  (34)
 20 PF02214 BTB_2:  BTB/POZ domain  24.2   1E+02  0.0022   18.8   2.8   23   60-83     40-62  (94)
 21 cd04677 Nudix_Hydrolase_18 Mem  24.2      80  0.0017   19.8   2.4   29   27-57     32-60  (132)
 22 cd02883 Nudix_Hydrolase Nudix   23.8      93   0.002   18.4   2.5   29   27-57     27-55  (123)
 23 cd03673 Ap6A_hydrolase Diadeno  22.8   1E+02  0.0022   19.1   2.6   29   27-57     29-57  (131)
 24 PF14714 KH_dom-like:  KH-domai  22.1 1.7E+02  0.0036   18.4   3.5   28   36-67     50-77  (80)
 25 KOG1785 Tyrosine kinase negati  21.5      61  0.0013   27.6   1.7   17   38-54    311-327 (563)
 26 PF14974 DUF4511:  Domain of un  21.1 1.8E+02   0.004   19.8   3.7   35   41-83     47-81  (105)
 27 COG4862 MecA Negative regulato  20.7      60  0.0013   25.0   1.4   26   39-67     37-62  (224)
 28 PF00126 HTH_1:  Bacterial regu  20.6 1.2E+02  0.0027   17.3   2.5   21   36-56     23-43  (60)
 29 PF04304 DUF454:  Protein of un  20.4      72  0.0016   19.0   1.5   21   37-57      5-25  (71)
 30 cd03397 PAP2_acid_phosphatase   20.4      73  0.0016   23.5   1.8   19   36-54    213-231 (232)
 31 TIGR00128 fabD malonyl CoA-acy  20.1      86  0.0019   22.6   2.1   20   38-57     23-42  (290)
 32 COG5646 Uncharacterized conser  20.0 1.1E+02  0.0024   21.6   2.5   36   42-79     69-108 (126)

No 1  
>PLN03220 uncharacterized protein; Provisional
Probab=99.96  E-value=1.3e-29  Score=172.22  Aligned_cols=78  Identities=46%  Similarity=0.835  Sum_probs=68.5

Q ss_pred             CCccchhhHHH-HHHhhhcCCCC-----CCCCCCCCcccee------------------cccCchHHHHHHHhHHHHhCC
Q 048251            1 MGFRLPGIVHA-KKILQKYPFNG-----PQSAKMTPEGYVA------------------DYLNQSLFQDLLSQAEKEFGF   56 (84)
Q Consensus         1 m~~~~~~~~~~-k~~~~~~~~~s-----~~~~~~vPkG~~a------------------~~L~hP~F~~LL~~AEEEfGf   56 (84)
                      ||++++.|.++ ||+++|++...     .+.+.+|||||||                  +|||||+|++||++|||||||
T Consensus         1 ~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~VPkGh~aVyVGe~~~~e~kRFVVPv~yL~hP~F~~LL~~AeEEfGf   80 (105)
T PLN03220          1 MGLSRFAISNATKQILKLNSLANRNRTSSSSSDHVPKGHVAVYVGEQIEMEKKRFVVPISFLNHPSFKEFLSRAEEEFGF   80 (105)
T ss_pred             CCcchhhhHHHHHHHHHHHhhcccccccccccCCCCCCeEEEEECCCCCccceEEEEEHHHcCChHHHHHHHHHHHHhCC
Confidence            99999999987 99999776211     1455689999999                  799999999999999999999


Q ss_pred             CCCCCCceeeecCCHHHHHHHHHH
Q 048251           57 DDHPAGGLLRIPCGEDVFTELISR   80 (84)
Q Consensus        57 ~~h~~G~Ll~IPCd~~~F~~vl~~   80 (84)
                      + |++|+| +||||++.|++++..
T Consensus        81 ~-~~~G~L-~IPCd~~~F~~ll~s  102 (105)
T PLN03220         81 N-HPMGGL-TIPCREEVFLDLIAS  102 (105)
T ss_pred             C-CCCCCE-EeeCCHHHHHHHHHh
Confidence            9 767999 999999999999863


No 2  
>PLN03090 auxin-responsive family protein; Provisional
Probab=99.96  E-value=1.6e-29  Score=171.36  Aligned_cols=78  Identities=40%  Similarity=0.632  Sum_probs=68.4

Q ss_pred             CCccchh----hHHHHHHhhhcCCCCCC-------CCCCCCcccee--------------cccCchHHHHHHHhHHHHhC
Q 048251            1 MGFRLPG----IVHAKKILQKYPFNGPQ-------SAKMTPEGYVA--------------DYLNQSLFQDLLSQAEKEFG   55 (84)
Q Consensus         1 m~~~~~~----~~~~k~~~~~~~~~s~~-------~~~~vPkG~~a--------------~~L~hP~F~~LL~~AEEEfG   55 (84)
                      ||++..+    ++++||+|+||++.+..       .+.+|||||||              +|||||+|++||++||||||
T Consensus         1 m~~~k~~ki~~~~~~kq~l~r~~s~~~~~~~~~~~~~~~vpkG~~aVyVG~~~~RfvVp~~~L~hP~F~~LL~~aeeEfG   80 (104)
T PLN03090          1 MAIKKSNKLTQTAMLKQILKRCSSLGKKQGYDEDGLPLDVPKGHFPVYVGENRSRYIVPISFLTHPEFQSLLQQAEEEFG   80 (104)
T ss_pred             CCcccccchhHHHHHHHHHHHHHHhcccCCcccccCCCCCCCCcEEEEECCCCEEEEEEHHHcCCHHHHHHHHHHHHHhC
Confidence            6776443    78999999999976521       35689999999              99999999999999999999


Q ss_pred             CCCCCCCceeeecCCHHHHHHHHHHh
Q 048251           56 FDDHPAGGLLRIPCGEDVFTELISRL   81 (84)
Q Consensus        56 f~~h~~G~Ll~IPCd~~~F~~vl~~i   81 (84)
                      |+ |+ |+| +||||++.|++++|+|
T Consensus        81 f~-~~-G~L-~IPC~~~~Fe~ll~~i  103 (104)
T PLN03090         81 FD-HD-MGL-TIPCEEVVFRSLTSMI  103 (104)
T ss_pred             CC-CC-CcE-EEeCCHHHHHHHHHHh
Confidence            99 65 899 9999999999999998


No 3  
>PLN03219 uncharacterized protein; Provisional
Probab=99.94  E-value=3.6e-27  Score=160.90  Aligned_cols=78  Identities=41%  Similarity=0.793  Sum_probs=66.5

Q ss_pred             CCccchhhHHHHHHhhhcCCC------CC----CCCCCCCcccee----------------cccCchHHHHHHHhHHHHh
Q 048251            1 MGFRLPGIVHAKKILQKYPFN------GP----QSAKMTPEGYVA----------------DYLNQSLFQDLLSQAEKEF   54 (84)
Q Consensus         1 m~~~~~~~~~~k~~~~~~~~~------s~----~~~~~vPkG~~a----------------~~L~hP~F~~LL~~AEEEf   54 (84)
                      ||+..+.+.+||||+|..+..      ++    ..+.+|||||||                +|||||+|++||++|||||
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vpkGh~aVYVG~~~E~kRFvVPi~yL~hP~F~~LL~~AeEEf   80 (108)
T PLN03219          1 MGLMRSMLPNAKQIFKSQSMRNKNGSSSPSSSTTTSGLVPKGHVAVYVGEQMEKKRFVVPISYLNHPLFREFLNRAEEEC   80 (108)
T ss_pred             CchHHHHHhhHHHHHHHHHHhcccCCCCCccCCCCCCCCCCCeEEEEECCCCCceEEEEEHHHcCChHHHHHHHHHHHHh
Confidence            888899999999999733211      11    234679999999                8999999999999999999


Q ss_pred             CCCCCCCCceeeecCCHHHHHHHHHH
Q 048251           55 GFDDHPAGGLLRIPCGEDVFTELISR   80 (84)
Q Consensus        55 Gf~~h~~G~Ll~IPCd~~~F~~vl~~   80 (84)
                      ||+ |++|+| +||||++.|+++++.
T Consensus        81 Gf~-~~~G~L-~IPCd~~~F~~ll~~  104 (108)
T PLN03219         81 GFH-HSMGGL-TIPCREESFLHLITS  104 (108)
T ss_pred             CCC-CCCCCE-EEeCCHHHHHHHHHh
Confidence            999 767999 999999999999975


No 4  
>PF02519 Auxin_inducible:  Auxin responsive protein;  InterPro: IPR003676 This family consists of the protein products of a gene cluster that encodes a group of auxin-regulated RNAs (small auxin up RNAs, SAURs) []. Proteins from this ARG7 auxin responsive genes family have no identified functional role [].
Probab=99.92  E-value=1.4e-25  Score=149.87  Aligned_cols=79  Identities=43%  Similarity=0.662  Sum_probs=64.8

Q ss_pred             CCccchhhHHHHHHhhhcCCCCC-------CCCCCCCcccee--------------cccCchHHHHHHHhHHHHhCCCCC
Q 048251            1 MGFRLPGIVHAKKILQKYPFNGP-------QSAKMTPEGYVA--------------DYLNQSLFQDLLSQAEKEFGFDDH   59 (84)
Q Consensus         1 m~~~~~~~~~~k~~~~~~~~~s~-------~~~~~vPkG~~a--------------~~L~hP~F~~LL~~AEEEfGf~~h   59 (84)
                      |..++..+.++|+...++.+.+.       +...+||+||||              +|||||+|++||++|||||||+ |
T Consensus         1 M~~~~k~~~~~~k~~~~~~~~~~~~~~~~~~~~~~vp~G~~~VyVG~~~~Rfvvp~~~L~hp~f~~LL~~aeeEfG~~-~   79 (100)
T PF02519_consen    1 MASRLKSLASAKKWQSRARSKSSSSSSSRSSSESDVPKGHFAVYVGEERRRFVVPVSYLNHPLFQELLEQAEEEFGFD-Q   79 (100)
T ss_pred             CccHHHHHHHHHhhhhhhhhcccccccccccccCCCCCCeEEEEeCccceEEEechHHcCchhHHHHHHHHhhhcCcC-C
Confidence            56667777777777665443220       123789999999              9999999999999999999999 6


Q ss_pred             CCCceeeecCCHHHHHHHHHHhc
Q 048251           60 PAGGLLRIPCGEDVFTELISRLN   82 (84)
Q Consensus        60 ~~G~Ll~IPCd~~~F~~vl~~i~   82 (84)
                       .|+| +||||++.|++++|+|+
T Consensus        80 -~G~l-~iPC~~~~Fe~~l~~le  100 (100)
T PF02519_consen   80 -DGPL-TIPCDVVLFEHLLWLLE  100 (100)
T ss_pred             -CCcE-EeeCCHHHHHHHHHHhC
Confidence             5999 99999999999999985


No 5  
>PRK02899 adaptor protein; Provisional
Probab=86.23  E-value=0.62  Score=34.20  Aligned_cols=25  Identities=36%  Similarity=0.864  Sum_probs=21.2

Q ss_pred             chHHHHHHHhHHHHhCCCCCCCCceeee
Q 048251           40 QSLFQDLLSQAEKEFGFDDHPAGGLLRI   67 (84)
Q Consensus        40 hP~F~~LL~~AEEEfGf~~h~~G~Ll~I   67 (84)
                      +-+|.++|++|..|+||.  ..||| +|
T Consensus        38 e~lF~~mm~Ea~~e~~F~--~~~pl-~~   62 (197)
T PRK02899         38 HQLFRDMMQEANKELGFE--ADGPI-AV   62 (197)
T ss_pred             HHHHHHHHHHhhhccCcc--cCCeE-EE
Confidence            457889999999999998  35998 76


No 6  
>PRK02315 adaptor protein; Provisional
Probab=79.50  E-value=1.4  Score=32.99  Aligned_cols=25  Identities=20%  Similarity=0.469  Sum_probs=21.6

Q ss_pred             chHHHHHHHhHHHHhCCCCCCCCceeee
Q 048251           40 QSLFQDLLSQAEKEFGFDDHPAGGLLRI   67 (84)
Q Consensus        40 hP~F~~LL~~AEEEfGf~~h~~G~Ll~I   67 (84)
                      +-+|..+|++|..|+||.  ..||| +|
T Consensus        38 e~fF~~mm~Ea~~e~~F~--~~~pl-~~   62 (233)
T PRK02315         38 EEFFYSMMDEVDEEDDFA--DEGPL-WF   62 (233)
T ss_pred             HHHHHHHHHHhccccCcc--cCCeE-EE
Confidence            458999999999999999  36998 76


No 7  
>PF05419 GUN4:  GUN4-like ;  InterPro: IPR008629 In Arabidopsis, GUN4 is required for the functioning of the plastid mediated repression of nuclear transcription that is involved in controlling the levels of magnesium- protoporphyrin IX. GUN4 binds the product and substrate of Mg-chelatase, an enzyme that produces Mg-Proto, and activates Mg-chelatase. GUN4 is thought to participate in plastid-to-nucleus signalling by regulating magnesium-protoporphyrin IX synthesis or trafficking.; PDB: 1Y6I_A 1Z3X_A 1Z3Y_A.
Probab=76.21  E-value=1  Score=31.36  Aligned_cols=18  Identities=22%  Similarity=0.440  Sum_probs=12.1

Q ss_pred             CCCCcccee------cccCchHHH
Q 048251           27 KMTPEGYVA------DYLNQSLFQ   44 (84)
Q Consensus        27 ~~vPkG~~a------~~L~hP~F~   44 (84)
                      ..+|+||+|      .+++||.++
T Consensus       109 l~AP~GHLP~~~~~~~~~~~~~~~  132 (132)
T PF05419_consen  109 LNAPKGHLPAVWWLSSLLSHPAWQ  132 (132)
T ss_dssp             TTS-TT--S-THHHHHHHTSCHHH
T ss_pred             CCCCCCCCccHHHHHHHHcCCCcC
Confidence            359999999      888998874


No 8  
>PF05389 MecA:  Negative regulator of genetic competence (MecA);  InterPro: IPR008681 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. This family contains several bacterial MecA proteins. In complex media competence development is poor, and there is little or no expression of late competence genes. Overexpression of MecA inhibits comG transcription [, , ]. MecA enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. Acts negatively in the development of competence by binding ComK and recruiting it to the ClpCP protease. When overexpressed, inhibits sporulation. Also involved in Spx degradation by ClpC. ; PDB: 3JTP_C 2Y1R_O 3PXI_c 3PXG_b 3JTO_D 3JTN_A.
Probab=75.74  E-value=0.88  Score=33.16  Aligned_cols=25  Identities=32%  Similarity=0.736  Sum_probs=0.0

Q ss_pred             chHHHHHHHhHHHHhCCCCCCCCceeee
Q 048251           40 QSLFQDLLSQAEKEFGFDDHPAGGLLRI   67 (84)
Q Consensus        40 hP~F~~LL~~AEEEfGf~~h~~G~Ll~I   67 (84)
                      +-+|..+|++|.+|+||. - .||| ++
T Consensus        38 e~fF~~ileea~~e~~F~-~-~~~l-~~   62 (220)
T PF05389_consen   38 EEFFYSILEEADEEHGFE-N-DGPL-TF   62 (220)
T ss_dssp             ----------------------------
T ss_pred             HHHHHHHHHHhccccCcc-c-CCeE-EE
Confidence            568999999999999999 3 6888 64


No 9  
>PF11834 DUF3354:  Domain of unknown function (DUF3354);  InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement. Inward rectifying potassium (K(+)in) channels play an important role in turgor regulation and ion uptake in higher plants. All of them comprise, from their N-terminal to their C-terminal ends: a short hydrophilic region, a hydrophobic region structurally analogous and partially homologous to the transmembrane domain of voltage-gated animal channels from the Shaker superfamily, a putative cyclic nucleotide-binding domain, and a conserved C-terminal KHA domain. Between these last two regions, some of them (AKT1, AKT2 and SKT1) contain an ankyrin-repeat domain with six repeats homologous to those of human erythrocyte ankyrin.  This entry represents the KHA domain which is unique to plant K(+)in channels. The KHA domain contains two high-homology blocks enriched for hydrophobic and acidic residues, respectively. The KHA domain is essential for interaction of plant K(+)in channels. The KHA domain mediates tetramerization and/or stabilisation of the heteromers [, , ]. 
Probab=50.00  E-value=15  Score=23.09  Aligned_cols=16  Identities=38%  Similarity=0.762  Sum_probs=15.0

Q ss_pred             HHHHHHHhHHHHhCCC
Q 048251           42 LFQDLLSQAEKEFGFD   57 (84)
Q Consensus        42 ~F~~LL~~AEEEfGf~   57 (84)
                      .+++||+.|++.||+.
T Consensus        27 SleeLl~ia~~kfg~~   42 (69)
T PF11834_consen   27 SLEELLKIASEKFGFS   42 (69)
T ss_pred             cHHHHHHHHHHHhCCC
Confidence            7899999999999986


No 10 
>PF02209 VHP:  Villin headpiece domain;  InterPro: IPR003128 Villin is an F-actin bundling protein involved in the maintenance of the microvilli of the absorptive epithelia. The villin-type "headpiece" domain is a modular motif found at the extreme C terminus of larger "core" domains in over 25 cytoskeletal proteins in plants and animals, often in assocation with the Gelsolin repeat. Although the headpiece is classified as an F-actin-binding domain, it has been shown that not all headpiece domains are intrinsically F-actin-binding motifs, surface charge distribution may be an important element for F-actin recognition []. An autonomously folding, 35 residue, thermostable subdomain (HP36) of the full-length 76 amino acid residue villin headpiece, is the smallest known example of a cooperatively folded domain of a naturally occurring protein. The structure of HP36, as determined by NMR spectroscopy, consists of three short helices surrounding a tightly packed hydrophobic core []. ; GO: 0003779 actin binding, 0007010 cytoskeleton organization; PDB: 1ZV6_A 1QZP_A 1UND_A 2PPZ_A 3TJW_B 1YU8_X 2JM0_A 1WY4_A 3MYC_A 1YU5_X ....
Probab=47.48  E-value=10  Score=21.24  Aligned_cols=19  Identities=26%  Similarity=0.553  Sum_probs=15.2

Q ss_pred             ccCchHHHHHHHhHHHHhC
Q 048251           37 YLNQSLFQDLLSQAEKEFG   55 (84)
Q Consensus        37 ~L~hP~F~~LL~~AEEEfG   55 (84)
                      ||+.-.|.+++.++.+||-
T Consensus         1 YLsd~dF~~vFgm~~~eF~   19 (36)
T PF02209_consen    1 YLSDEDFEKVFGMSREEFY   19 (36)
T ss_dssp             GS-HHHHHHHHSS-HHHHH
T ss_pred             CcCHHHHHHHHCCCHHHHH
Confidence            7888999999999999984


No 11 
>PF02100 ODC_AZ:  Ornithine decarboxylase antizyme;  InterPro: IPR002993 Ornithine decarboxylase antizyme (ODC-AZ) [] binds to, and destabilises, ornithine decarboxylase (ODC), a key enzyme in polyamine synthesis. ODC is then rapidly degraded. The expression of ODC-AZ requires programmed, ribosomal frameshifting which is modulated according to the cellular concentration of polyamines. High levels of polyamines induce a +1 ribosomal frameshift in the translation of mRNA for the antizyme leading to the expression of a full-length protein. At least two forms of ODC-AZ exist in mammals [] and the protein has been found in Drosophila (protein Gutfeeling).; GO: 0004857 enzyme inhibitor activity, 0008073 ornithine decarboxylase inhibitor activity; PDB: 1ZO0_A.
Probab=43.22  E-value=19  Score=24.10  Aligned_cols=46  Identities=17%  Similarity=0.226  Sum_probs=21.1

Q ss_pred             CCccceecccCchHHHHHHHhHHHHhCCCCCCCCceeeecCCHHHHHHHHH
Q 048251           29 TPEGYVADYLNQSLFQDLLSQAEKEFGFDDHPAGGLLRIPCGEDVFTELIS   79 (84)
Q Consensus        29 vPkG~~a~~L~hP~F~~LL~~AEEEfGf~~h~~G~Ll~IPCd~~~F~~vl~   79 (84)
                      +|.+.. .--.-..|.+||+.|||.+|.+ |   .++.++=+......++.
T Consensus        30 ip~~~~-~~~~K~~lvaLLElAee~L~c~-~---vvic~~k~~~d~~~Llr   75 (108)
T PF02100_consen   30 IPSSAL-GQGSKESLVALLELAEEKLGCS-H---VVICLDKNRPDRASLLR   75 (108)
T ss_dssp             -SS----SS--SHHHHHHHHHHHHHH--------EEEEE---SS-HHHHHH
T ss_pred             ECCccc-ccccHHHHHHHHHHhcCcCCCC-E---EEEEEECCchhHHHhhh
Confidence            455444 3335568999999999999987 3   23255544444444444


No 12 
>smart00153 VHP Villin headpiece domain.
Probab=42.12  E-value=15  Score=20.48  Aligned_cols=19  Identities=26%  Similarity=0.583  Sum_probs=16.7

Q ss_pred             ccCchHHHHHHHhHHHHhC
Q 048251           37 YLNQSLFQDLLSQAEKEFG   55 (84)
Q Consensus        37 ~L~hP~F~~LL~~AEEEfG   55 (84)
                      ||+.-.|+..+.++.+||-
T Consensus         1 yLsdeeF~~vfgmsr~eF~   19 (36)
T smart00153        1 YLSDEDFEEVFGMTREEFY   19 (36)
T ss_pred             CCCHHHHHHHHCCCHHHHH
Confidence            7888899999999999984


No 13 
>PF12058 DUF3539:  Protein of unknown function (DUF3539);  InterPro: IPR021926  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 90 amino acids in length. This protein has a conserved NHP sequence motif. ; PDB: 3N5B_B 2XKO_C 2XG8_F.
Probab=38.22  E-value=6.9  Score=26.17  Aligned_cols=11  Identities=45%  Similarity=0.664  Sum_probs=7.6

Q ss_pred             cccCchHHHHH
Q 048251           36 DYLNQSLFQDL   46 (84)
Q Consensus        36 ~~L~hP~F~~L   46 (84)
                      .|||||.|.-|
T Consensus         4 ~YLNHPtFGlL   14 (88)
T PF12058_consen    4 TYLNHPTFGLL   14 (88)
T ss_dssp             -EEEETTTEEE
T ss_pred             ccccCCccchh
Confidence            58999988543


No 14 
>PF09781 NDUF_B5:  NADH:ubiquinone oxidoreductase, NDUFB5/SGDH subunit;  InterPro: IPR019173  Members of this family mediate the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone, the reaction that occurs being: NADH + ubiquinone = NAD(+) + ubiquinol [, ]. 
Probab=36.54  E-value=25  Score=26.31  Aligned_cols=24  Identities=21%  Similarity=0.434  Sum_probs=19.3

Q ss_pred             CCCCCCCcccee---cccCchHHHHHH
Q 048251           24 QSAKMTPEGYVA---DYLNQSLFQDLL   47 (84)
Q Consensus        24 ~~~~~vPkG~~a---~~L~hP~F~~LL   47 (84)
                      ..-.++|+||.|   +|-+||+=|-+-
T Consensus        94 AeLaeIPEgY~P~hWEY~kHPItR~iA  120 (187)
T PF09781_consen   94 AELAEIPEGYEPEHWEYYKHPITRWIA  120 (187)
T ss_pred             eeeccCCCCCCCcceeeccCcHHHHHH
Confidence            344689999999   999999877553


No 15 
>PF07425 Pardaxin:  Pardaxin;  InterPro: IPR009990 This family consists of several Pardaxin proteins. Pardaxin, a 33-amino-acid pore-forming polypeptide toxin isolated from the Red Sea Moses sole Pardachirus marmoratus, has a helix-hinge-helix structure. This is a common structural motif found both in antibacterial peptides that can act selectively on bacterial membranes (e.g., cecropin), and in cytotoxic peptides that can lyse both mammalian and bacterial cells (e.g., melittin). Pardaxin possesses a high antibacterial activity with a significantly reduced haemolytic activity towards human red blood cells compared with melittin []. Pardaxin has also been found to have a shark repellent action [].; GO: 0005576 extracellular region; PDB: 1XC0_A 2KNS_A.
Probab=33.22  E-value=13  Score=20.55  Aligned_cols=19  Identities=26%  Similarity=0.492  Sum_probs=14.7

Q ss_pred             cccCchHHHHHHHhHHHHh
Q 048251           36 DYLNQSLFQDLLSQAEKEF   54 (84)
Q Consensus        36 ~~L~hP~F~~LL~~AEEEf   54 (84)
                      ..++.|+|..||.......
T Consensus         8 kiissplfktllsavgsal   26 (33)
T PF07425_consen    8 KIISSPLFKTLLSAVGSAL   26 (33)
T ss_dssp             HHCCTTTCHHHHHHHHHHC
T ss_pred             HHHccHHHHHHHHHHHHHH
Confidence            6788999999998765443


No 16 
>PF08861 DUF1828:  Domain of unknown function DUF1828;  InterPro: IPR014960 These proteins are functionally uncharacterised. 
Probab=30.21  E-value=1.4e+02  Score=18.64  Aligned_cols=39  Identities=23%  Similarity=0.336  Sum_probs=31.7

Q ss_pred             chHHHHHHHhHHHHhCCCCCCCCceeeecCCHHHHHHHHHH
Q 048251           40 QSLFQDLLSQAEKEFGFDDHPAGGLLRIPCGEDVFTELISR   80 (84)
Q Consensus        40 hP~F~~LL~~AEEEfGf~~h~~G~Ll~IPCd~~~F~~vl~~   80 (84)
                      .+-=+++|+..-..||+. -..|.| .+.++.+.|-..+..
T Consensus        44 s~~R~~~l~~il~~~gv~-~~~~el-~~~~~~~~~~~~~~~   82 (90)
T PF08861_consen   44 SKKRKKILNSILNGFGVE-LDEGEL-FIKTSEENFPQAKHR   82 (90)
T ss_pred             chHHHHHHHHHHHHcCcc-ccCCEE-EEEeCHHHHHHHHHH
Confidence            566778999999999998 466888 999999988765543


No 17 
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only]
Probab=26.20  E-value=50  Score=26.05  Aligned_cols=30  Identities=27%  Similarity=0.517  Sum_probs=22.5

Q ss_pred             CCCcccee-------------cccC--chHHHHHHHhHHHHhCCC
Q 048251           28 MTPEGYVA-------------DYLN--QSLFQDLLSQAEKEFGFD   57 (84)
Q Consensus        28 ~vPkG~~a-------------~~L~--hP~F~~LL~~AEEEfGf~   57 (84)
                      -.|||+++             .-|.  --.++++|++-||-|||.
T Consensus        76 ~~p~~~~~~~~~~r~~~g~~~~elg~~l~~ire~l~kLee~~g~~  120 (274)
T COG3769          76 YLPKGWFPFDGKPREISGISHIELGKVLEKIREKLDKLEEHFGFT  120 (274)
T ss_pred             EecccccccCCCCceecceEeeehhhhHHHHHHHHHHHHHHhCee
Confidence            36999999             1122  235899999999999985


No 18 
>KOG1748 consensus Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion; Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism]
Probab=26.02  E-value=44  Score=23.72  Aligned_cols=49  Identities=20%  Similarity=0.327  Sum_probs=30.4

Q ss_pred             CCCcccee-----cccCchHHHHHHHhHHHHhCCCCCCCC-ceeeecCCHHHHHHHHHHh
Q 048251           28 MTPEGYVA-----DYLNQSLFQDLLSQAEKEFGFDDHPAG-GLLRIPCGEDVFTELISRL   81 (84)
Q Consensus        28 ~vPkG~~a-----~~L~hP~F~~LL~~AEEEfGf~~h~~G-~Ll~IPCd~~~F~~vl~~i   81 (84)
                      ..+..+|-     +-|.|=   ++.=--||||||. =+.+ += .|-|-.+.+++|....
T Consensus        73 ~~~~s~f~~DLGlDSLD~V---EiVMAlEEEFgiE-Ipd~dAd-ki~t~~da~~yI~~~~  127 (131)
T KOG1748|consen   73 LTTDSDFFKDLGLDSLDTV---EIVMALEEEFGIE-IPDEDAD-KIKTVRDAADYIADKP  127 (131)
T ss_pred             cchhhHHHHhcCCcccccc---hhhhhhHHHhCCc-cCcchhh-hhCCHHHHHHHHHhcc
Confidence            45666665     555553   3334458999996 3333 34 6677777888876643


No 19 
>PF12518 DUF3721:  Protein of unknown function;  InterPro: IPR022196  This domain family is found in bacteria and eukaryotes, and is approximately 30 amino acids in length. There is a conserved WMPC sequence motif. There are two completely conserved residues (A and C) that may be functionally important. 
Probab=25.29  E-value=50  Score=18.39  Aligned_cols=23  Identities=30%  Similarity=0.674  Sum_probs=16.5

Q ss_pred             HhHHHHhCCC-CCCCCceeeecCCH
Q 048251           48 SQAEKEFGFD-DHPAGGLLRIPCGE   71 (84)
Q Consensus        48 ~~AEEEfGf~-~h~~G~Ll~IPCd~   71 (84)
                      ++.+.+||-. .|++|.. ..||+.
T Consensus         8 e~~A~~~GC~G~H~mg~~-WMPC~~   31 (34)
T PF12518_consen    8 EKRAKELGCKGAHKMGDK-WMPCSN   31 (34)
T ss_pred             HHHHHHcCCcchhhccCc-cccCcc
Confidence            4556678862 2678998 999974


No 20 
>PF02214 BTB_2:  BTB/POZ domain;  InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. The Kv family can be divided into several subfamilies on the basis of sequence similarity and function. Four of these subfamilies, Kv1 (Shaker), Kv2 (Shab), Kv3 (Shaw) and Kv4 (Shal), consist of pore-forming alpha subunits that associate with different types of beta subunit. Each alpha subunit comprises six hydrophobic TM domains with a P-domain between the fifth and sixth, which partially resides in the membrane. The fourth TM domain has positively charged residues at every third residue and acts as a voltage sensor, which triggers the conformational change that opens the channel pore in response to a displacement in membrane potential []. More recently, 4 new electrically-silent alpha subunits have been cloned: Kv5 (KCNF), Kv6 (KCNG), Kv8 and Kv9 (KCNS). These subunits do not themselves possess any functional activity, but appear to form heteromeric channels with Kv2 subunits, and thus modulate Shab channel activity []. When highly expressed, they inhibit channel activity, but at lower levels show more specific modulatory actions. The N-terminal, cytoplasmic tetramerization domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels []. This domain is found in a subset of a larger group of proteins that contain the BTB/POZ domain.; GO: 0005249 voltage-gated potassium channel activity, 0006813 potassium ion transport, 0008076 voltage-gated potassium channel complex, 0016020 membrane; PDB: 1NN7_A 3KVT_A 1EXB_E 1QDV_A 1DSX_E 1QDW_F 3LUT_B 3LNM_B 2A79_B 3DRY_C ....
Probab=24.19  E-value=1e+02  Score=18.84  Aligned_cols=23  Identities=17%  Similarity=0.293  Sum_probs=18.9

Q ss_pred             CCCceeeecCCHHHHHHHHHHhcc
Q 048251           60 PAGGLLRIPCGEDVFTELISRLNK   83 (84)
Q Consensus        60 ~~G~Ll~IPCd~~~F~~vl~~i~~   83 (84)
                      ..|.+ -|-+|...|++|+..++.
T Consensus        40 ~~~~~-fiDRdp~~F~~IL~ylr~   62 (94)
T PF02214_consen   40 DDGEY-FIDRDPELFEYILNYLRT   62 (94)
T ss_dssp             TTTEE-EESS-HHHHHHHHHHHHH
T ss_pred             ccceE-EeccChhhhhHHHHHHhh
Confidence            35889 999999999999998764


No 21 
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=24.15  E-value=80  Score=19.84  Aligned_cols=29  Identities=24%  Similarity=0.307  Sum_probs=24.2

Q ss_pred             CCCCccceecccCchHHHHHHHhHHHHhCCC
Q 048251           27 KMTPEGYVADYLNQSLFQDLLSQAEKEFGFD   57 (84)
Q Consensus        27 ~~vPkG~~a~~L~hP~F~~LL~~AEEEfGf~   57 (84)
                      -..|.|++-  -+.....++++...||-|+.
T Consensus        32 w~~PgG~v~--~gEt~~~aa~REl~EE~Gi~   60 (132)
T cd04677          32 WGLPGGAME--LGESLEETARRELKEETGLE   60 (132)
T ss_pred             EECCeeecC--CCCCHHHHHHHHHHHHhCCe
Confidence            468999985  35568899999999999997


No 22 
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzy
Probab=23.84  E-value=93  Score=18.40  Aligned_cols=29  Identities=24%  Similarity=0.345  Sum_probs=22.1

Q ss_pred             CCCCccceecccCchHHHHHHHhHHHHhCCC
Q 048251           27 KMTPEGYVADYLNQSLFQDLLSQAEKEFGFD   57 (84)
Q Consensus        27 ~~vPkG~~a~~L~hP~F~~LL~~AEEEfGf~   57 (84)
                      -..|.|++..  +......+++..+||.|+.
T Consensus        27 ~~~p~G~~~~--~e~~~~~a~RE~~EE~Gl~   55 (123)
T cd02883          27 WELPGGGVEP--GETLEEAAIREVREETGLD   55 (123)
T ss_pred             EeCCcccccC--CCCHHHHHHHHHHHhhCcc
Confidence            4678888752  3335689999999999987


No 23 
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily. Ap6A hydrolase specifically hydrolyzes diadenosine polyphosphates, but not ATP or diadenosine triphosphate, and it generates ATP as the product. Ap6A, the most preferred substrate, hydrolyzes to produce two ATP molecules, which is a novel hydrolysis mode for Ap6A. These results indicate that Ap6A  hydrolase is a diadenosine polyphosphate hydrolase. It requires the presence of a divalent cation, such as Mn2+, Mg2+, Zn2+, and Co2+, for activity. Members of the Nudix superfamily are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site.
Probab=22.83  E-value=1e+02  Score=19.13  Aligned_cols=29  Identities=17%  Similarity=0.246  Sum_probs=24.2

Q ss_pred             CCCCccceecccCchHHHHHHHhHHHHhCCC
Q 048251           27 KMTPEGYVADYLNQSLFQDLLSQAEKEFGFD   57 (84)
Q Consensus        27 ~~vPkG~~a~~L~hP~F~~LL~~AEEEfGf~   57 (84)
                      -..|.|++-  -+...-++..+...||-|+.
T Consensus        29 w~~PgG~v~--~gEs~~~aa~REl~EEtGl~   57 (131)
T cd03673          29 WSLPKGKLE--PGETPPEAAVREVEEETGIR   57 (131)
T ss_pred             ccCCCCccC--CCCCHHHHHHHHHhhhhCCc
Confidence            468999985  35678889999999999997


No 24 
>PF14714 KH_dom-like:  KH-domain-like of EngA bacterial GTPase enzymes, C-terminal; PDB: 2HJG_A 1MKY_A.
Probab=22.12  E-value=1.7e+02  Score=18.39  Aligned_cols=28  Identities=29%  Similarity=0.471  Sum_probs=17.9

Q ss_pred             cccCchHHHHHHHhHHHHhCCCCCCCCceeee
Q 048251           36 DYLNQSLFQDLLSQAEKEFGFDDHPAGGLLRI   67 (84)
Q Consensus        36 ~~L~hP~F~~LL~~AEEEfGf~~h~~G~Ll~I   67 (84)
                      +++....-+-|.++-.|+|||.   +-|| .|
T Consensus        50 ~~~~~sY~ryL~n~lRe~f~f~---G~Pi-~l   77 (80)
T PF14714_consen   50 ELLPESYKRYLENQLREAFGFE---GVPI-RL   77 (80)
T ss_dssp             CC--HHHHHHHHHHHHHHH--T---TS---EE
T ss_pred             ccCCHHHHHHHHHHHHHHCCCC---ceeE-EE
Confidence            7788888899999999999998   2466 54


No 25 
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]
Probab=21.46  E-value=61  Score=27.63  Aligned_cols=17  Identities=41%  Similarity=0.638  Sum_probs=15.0

Q ss_pred             cCchHHHHHHHhHHHHh
Q 048251           38 LNQSLFQDLLSQAEKEF   54 (84)
Q Consensus        38 L~hP~F~~LL~~AEEEf   54 (84)
                      -|.|+||+|++-..|.|
T Consensus       311 ~NKpL~QaL~eG~keGF  327 (563)
T KOG1785|consen  311 QNKPLFQALLEGHKEGF  327 (563)
T ss_pred             CCcHHHHHHHhccccce
Confidence            47899999999988877


No 26 
>PF14974 DUF4511:  Domain of unknown function (DUF4511)
Probab=21.08  E-value=1.8e+02  Score=19.80  Aligned_cols=35  Identities=26%  Similarity=0.508  Sum_probs=21.5

Q ss_pred             hHHHHHHHhHHHHhCCCCCCCCceeeecCCHHHHHHHHHHhcc
Q 048251           41 SLFQDLLSQAEKEFGFDDHPAGGLLRIPCGEDVFTELISRLNK   83 (84)
Q Consensus        41 P~F~~LL~~AEEEfGf~~h~~G~Ll~IPCd~~~F~~vl~~i~~   83 (84)
                      |+..++--.+=..|||.+ +.+|+       ..|.+++..+++
T Consensus        47 Pva~qiq~~VIk~yGF~~-~~eG~-------~~f~~~i~~~e~   81 (105)
T PF14974_consen   47 PVATQIQMEVIKKYGFPE-SREGV-------MQFAQLIRELEK   81 (105)
T ss_pred             HHHHHHHHHHHHHcCCCC-CcchH-------HHHHHHHHHHHc
Confidence            444444455556799984 33444       378888776654


No 27 
>COG4862 MecA Negative regulator of genetic competence, sporulation and motility [Posttranslational modification, protein turnover, chaperones / Signal transduction mechanisms / Cell motility and secretion]
Probab=20.72  E-value=60  Score=25.01  Aligned_cols=26  Identities=27%  Similarity=0.486  Sum_probs=22.5

Q ss_pred             CchHHHHHHHhHHHHhCCCCCCCCceeee
Q 048251           39 NQSLFQDLLSQAEKEFGFDDHPAGGLLRI   67 (84)
Q Consensus        39 ~hP~F~~LL~~AEEEfGf~~h~~G~Ll~I   67 (84)
                      .|-+|.++++.+.+|=+|.  ..||| +|
T Consensus        37 ~EE~F~~mMdEl~~ee~F~--~~GpL-~i   62 (224)
T COG4862          37 TEELFYEMMDELNLEEDFK--DEGPL-WI   62 (224)
T ss_pred             HHHHHHHHHHhcCCccccc--cCCce-EE
Confidence            3678999999999999998  36999 76


No 28 
>PF00126 HTH_1:  Bacterial regulatory helix-turn-helix protein, lysR family;  InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. These proteins are very diverse, but for convenience may be grouped into subfamilies on the basis of sequence similarity. One such family, the lysR family, groups together a range of proteins, including ampR, catM, catR, cynR, cysB, gltC, iciA, ilvY, irgB, lysR, metR, mkaC, mleR, nahR, nhaR, nodD, nolR, oxyR, pssR, rbcR, syrM, tcbR, tfdS and trpI [, , , , ]. The majority of these proteins appear to be transcription activators and most are known to negatively regulate their own expression. All possess a potential HTH DNA-binding motif towards their N-termini.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 3T1B_D 3SZP_A 1O7L_C 1B9N_A 1B9M_A 3FZJ_J 3FXR_B 3FXQ_A 3FXU_A 2IJL_B ....
Probab=20.64  E-value=1.2e+02  Score=17.30  Aligned_cols=21  Identities=29%  Similarity=0.308  Sum_probs=18.5

Q ss_pred             cccCchHHHHHHHhHHHHhCC
Q 048251           36 DYLNQSLFQDLLSQAEKEFGF   56 (84)
Q Consensus        36 ~~L~hP~F~~LL~~AEEEfGf   56 (84)
                      -.++.|.+..-+++-|+++|.
T Consensus        23 l~is~~~vs~~i~~LE~~lg~   43 (60)
T PF00126_consen   23 LGISQSAVSRQIKQLEEELGV   43 (60)
T ss_dssp             CTSSHHHHHHHHHHHHHHHTS
T ss_pred             hhccchHHHHHHHHHHHHhCC
Confidence            467889999999999999995


No 29 
>PF04304 DUF454:  Protein of unknown function (DUF454);  InterPro: IPR007401 This is a predicted membrane protein.
Probab=20.44  E-value=72  Score=19.01  Aligned_cols=21  Identities=29%  Similarity=0.425  Sum_probs=18.0

Q ss_pred             ccCchHHHHHHHhHHHHhCCC
Q 048251           37 YLNQSLFQDLLSQAEKEFGFD   57 (84)
Q Consensus        37 ~L~hP~F~~LL~~AEEEfGf~   57 (84)
                      .+|||.|+..++.-+|.=|.+
T Consensus         5 l~~h~~~g~~I~~w~~~r~i~   25 (71)
T PF04304_consen    5 LLNHRLFGPYIRNWEEHRGIP   25 (71)
T ss_pred             HHcCchhHHHHHHHHHCCCcC
Confidence            479999999999999877765


No 30 
>cd03397 PAP2_acid_phosphatase PAP2, bacterial acid phosphatase or class A non-specific acid phosphatases. These enzymes catalyze phosphomonoester hydrolysis, with optimal activity in low pH conditions. They are secreted into the periplasmic space, and their physiological role remains to be determined.
Probab=20.41  E-value=73  Score=23.51  Aligned_cols=19  Identities=26%  Similarity=0.333  Sum_probs=17.7

Q ss_pred             cccCchHHHHHHHhHHHHh
Q 048251           36 DYLNQSLFQDLLSQAEKEF   54 (84)
Q Consensus        36 ~~L~hP~F~~LL~~AEEEf   54 (84)
                      .+++.|.|++.+++|..|+
T Consensus       213 ~l~~~~~f~~~~~~A~~El  231 (232)
T cd03397         213 ALLADPAFAADLAAARAEL  231 (232)
T ss_pred             HHhcCHHHHHHHHHHHHHh
Confidence            8889999999999999986


No 31 
>TIGR00128 fabD malonyl CoA-acyl carrier protein transacylase. The seed alignment for this family of proteins contains a single member each from a number of bacterial species but also an additional pair of closely related, uncharacterized proteins from B. subtilis, one of which has a long C-terminal extension.
Probab=20.13  E-value=86  Score=22.60  Aligned_cols=20  Identities=25%  Similarity=0.546  Sum_probs=17.4

Q ss_pred             cCchHHHHHHHhHHHHhCCC
Q 048251           38 LNQSLFQDLLSQAEKEFGFD   57 (84)
Q Consensus        38 L~hP~F~~LL~~AEEEfGf~   57 (84)
                      -++|.|++.++++.+-.|++
T Consensus        23 ~~~p~~~~~~~~~~~~lg~~   42 (290)
T TIGR00128        23 EQYPIAKELFDQASEALGYD   42 (290)
T ss_pred             HcCHHHHHHHHHHHHHhCcC
Confidence            37899999999999988864


No 32 
>COG5646 Uncharacterized conserved protein [Function unknown]
Probab=20.05  E-value=1.1e+02  Score=21.61  Aligned_cols=36  Identities=28%  Similarity=0.449  Sum_probs=25.2

Q ss_pred             HHHHHHHhHHHHhCCCCCCCCceeeecCC----HHHHHHHHH
Q 048251           42 LFQDLLSQAEKEFGFDDHPAGGLLRIPCG----EDVFTELIS   79 (84)
Q Consensus        42 ~F~~LL~~AEEEfGf~~h~~G~Ll~IPCd----~~~F~~vl~   79 (84)
                      .+-.=....--++||+ +..|-| ++|-+    -+.|+.++.
T Consensus        69 ~gI~~fa~~l~~~~yd-~tkg~i-rfp~~~pvd~~ll~~~i~  108 (126)
T COG5646          69 AGIDAFADELKEAGYD-YTKGTI-RFPWKAPVDYDLLKKMIE  108 (126)
T ss_pred             cchHHHHHHHhhhccc-ccceeE-ecCccCcCCHHHHHHHHH
Confidence            4555556666788999 788999 99987    345555543


Done!