Citrus Sinensis ID: 048287


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MLDKMPEDTIPNGFVQNSVIAGSNNPPNTAAKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDALAEETARVNAASSMNSLANGSISYHFMGTPLGPSVAQHFSSIFKPIPGGGADETIDQTRRGLSLWMAPGSQGHETVGSNLTEIQQLGSVSSEAMYGDHPPPSDYHFNWVFGNNKQSSNNAAEAPAIASASLPLTGVKEAAATASHHHQLVSVNVPSLYSSQQQQTTTHQTQAAAAAAN
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccHHcccccHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHHHcc
cHHHHHHcccccccccccccccccccccccHHHccccccccccccEEEEEcHHHHHHcccEEEHHHcccccccccccHccccccccccHccccccccEEEEEEcccccccccccHHccccccHHHHHHcccccccccEEccccccEEEHccHHHHHcccccccEEcccccEEEcccccHcHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccHHHHHHHccccccccccccHHHHHHHHcccccccHHHHHHcc
mldkmpedtipngfvqnsviagsnnppntaakkkrnlpgtpdpeaevialspktlMATNRFLCEicgkgfqrdqnlqlhrrghnlpwklkqrtskevrkrvyvcpektcvhhhpsralgdltgiKKHFcrkhgekkwkcekcskryavqsdwkahsktcgtreykcdcgtvfsrrdsfITHRAFCDALAEETARVNAASSMNSlangsisyhfmgtplgpsvaqhfssifkpipgggadetiDQTRRGLslwmapgsqghetvgsnLTEIQQLgsvsseamygdhpppsdyhfnwvfgnnkqssnnaaeapaiasaslpltgvKEAAAtashhhqlvsvnvpslyssqqqQTTTHQTQAAAAAAN
mldkmpedtipNGFVQNSVIAGSNNPPNTAAKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRdqnlqlhrrghnlpwklkqrtskevrKRVYVCpektcvhhhpsralgdltgiKKHFCRKhgekkwkcekcskryavqsdwkahsktcgtreykcdcgtVFSRRDSFITHRAFCDALAEETARVNAASSMNSLANGSISYHFMGTPLGPSVAQHFSSIFKPIPGGGADETIDQTRRGLSLWMAPGSQGHETVGSNLTEIQQLGSVSSEAMYGDHPPPSDYHFNWVFGNNKQSSNNAAEAPAIASASLPLTGVKEAAATASHHHQLVSVNVPSLYSSQQQQTTTHQTQAAAAAAN
MLDKMPEDTIPNGFVQNSVIAGSNNPPNTAAKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDALAEETARVNAASSMNSLANGSISYHFMGTPLGPSVAQHFSSIFKPIPGGGADETIDQTRRGLSLWMAPGSQGHETVGSNLTEIQQLGSVSSEAMYGDHPPPSDYHFNWVFGNNKQssnnaaeapaiasasLPLTGVKEAAATASHHHQLVSVNVPSLYSSqqqqttthqtqaaaaaaN
**********************************************VIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDALAEETARVNA******LANGSISYHFMGTPLGPSVAQHFSSIFKPIP**************LSLW**************************************YHFNWVFG*******************************************************************
*****PE***PNG*****************AKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDALAEETAR***************************************************************************************************************************************************************************
MLDKMPEDTIPNGFVQNSVIAGSNNPPNTAAKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDALAEETARVNAASSMNSLANGSISYHFMGTPLGPSVAQHFSSIFKPIPGGGADETIDQTRRGLSLWMAPGSQGHETVGSNLTEIQQLGSVSSEAMYGDHPPPSDYHFNWVFGNNKQSSNNAAEAPAIASASLPLTGVKEAAATASHHHQLVSVNVPSL*********************
************************************LPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDALAEETARVNAASSMNSLANGSISYHFMGTPLGPSVAQHFSSIFKPIP************************************************GD*PPPSDYHFN***********************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDKMPEDTIPNGFVQNSVIAGSNNPPNTAAKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDALAEETARVNAASSMNSLANGSISYHFMGTPLGPSVAQHFSSIFKPIPGGGADETIDQTRRGLSLWMAPGSQGHETVGSNLTEIQQLGSVSSEAMYGDHPPPSDYHFNWVFGNNKQSSNNAAEAPAIASASLPLTGVKEAAATASHHHQLVSVNVPSLYSSQQQQTTTHQTQAAAAAAN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
Q9ZWA6 506 Zinc finger protein MAGPI yes no 0.846 0.610 0.601 1e-107
Q9FFH3 466 Zinc finger protein NUTCR no no 0.657 0.515 0.648 1e-102
Q700D2 503 Zinc finger protein JACKD no no 0.476 0.345 0.817 4e-87
Q943I6522 Zinc finger protein STOP1 no no 0.463 0.323 0.326 2e-22
Q9C8N5499 Protein SENSITIVE TO PROT no no 0.394 0.288 0.335 4e-21
Q2QX40465 Zinc finger protein STAR3 no no 0.378 0.296 0.346 1e-19
Q8VWG3303 Protein TRANSPARENT TESTA no no 0.380 0.458 0.350 3e-15
O43313 823 ATM interactor OS=Homo sa yes no 0.389 0.172 0.320 6e-13
Q6P9S1 818 ATM interactor OS=Mus mus yes no 0.326 0.145 0.314 3e-12
Q14590738 Zinc finger protein 235 O no no 0.435 0.215 0.261 3e-08
>sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Back     alignment and function desciption
 Score =  389 bits (998), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 237/346 (68%), Gaps = 37/346 (10%)

Query: 25  NPPNTAAKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHN 84
           NPP    KKKRNLPG PDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHN
Sbjct: 36  NPP--LVKKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHN 93

Query: 85  LPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSK 144
           LPWKLKQRTSKEVRKRVYVCPEK+CVHHHP+RALGDLTGIKKHFCRKHGEKKWKCEKC+K
Sbjct: 94  LPWKLKQRTSKEVRKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCAK 153

Query: 145 RYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDALAEETARVNAASSMNSL 204
           RYAVQSDWKAHSKTCGTREY+CDCGT+FSRRDSFITHRAFCDALAEETAR+NAAS + S 
Sbjct: 154 RYAVQSDWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDALAEETARLNAASHLKSF 213

Query: 205 ---ANGSISYHF-MGTPL-------------GPSVAQHFSSIFKPIPGGGAD-ETIDQTR 246
              A  +++YH+ MGT +             GP   QH      PI     D + + +  
Sbjct: 214 AATAGSNLNYHYLMGTLIPSPSLPQPPSFPFGPPQPQHHHHHQFPITTNNFDHQDVMKPA 273

Query: 247 RGLSLWMAPGSQGHETVGSNLTEIQQLGSVSSEAMYGDHPPPSDYHFNWVFGNNKQSSNN 306
             LSLW           G N+   QQ+ ++        H P  DY  NWVFGN    +NN
Sbjct: 274 STLSLWS----------GGNINHHQQV-TIEDRMAPQPHSPQEDY--NWVFGN----ANN 316

Query: 307 AAEAPAIASASLPLTGVKEAAATASHHHQLVSVNVPSLYSSQQQQT 352
             E    + + +          +  + +   S++VPSL+SS  Q T
Sbjct: 317 HGELITTSDSLITHDNNINIVQSKENANGATSLSVPSLFSSVDQIT 362




Probable transcription factor that regulates tissue boundaries and asymmetric cell division. Might be involved in the sequestration of 'SHORT-ROOT' to the nucleus.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FFH3|NUC_ARATH Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1 Back     alignment and function description
>sp|Q700D2|JKD_ARATH Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1 Back     alignment and function description
>sp|Q943I6|STOP1_ORYSJ Zinc finger protein STOP1 homolog OS=Oryza sativa subsp. japonica GN=Os01g0871200 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8N5|STOP1_ARATH Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1 Back     alignment and function description
>sp|Q2QX40|ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica GN=STAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Back     alignment and function description
>sp|O43313|ATMIN_HUMAN ATM interactor OS=Homo sapiens GN=ATMIN PE=1 SV=2 Back     alignment and function description
>sp|Q6P9S1|ATMIN_MOUSE ATM interactor OS=Mus musculus GN=Atmin PE=2 SV=2 Back     alignment and function description
>sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
359485408450 PREDICTED: zinc finger protein MAGPIE-li 0.909 0.737 0.747 1e-147
302143346427 unnamed protein product [Vitis vinifera] 0.865 0.740 0.722 1e-138
224132860 479 predicted protein [Populus trichocarpa] 0.868 0.661 0.727 1e-134
147819361403 hypothetical protein VITISV_003666 [Viti 0.780 0.707 0.754 1e-127
356545021 466 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.920 0.721 0.629 1e-126
356546983 468 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.915 0.713 0.642 1e-125
356542167 475 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.928 0.713 0.635 1e-122
255553609437 nucleic acid binding protein, putative [ 0.810 0.677 0.708 1e-122
356515128 472 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.835 0.646 0.684 1e-119
297848602 509 hypothetical protein ARALYDRAFT_470357 [ 0.852 0.611 0.6 1e-106
>gi|359485408|ref|XP_002275400.2| PREDICTED: zinc finger protein MAGPIE-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 269/360 (74%), Positives = 294/360 (81%), Gaps = 28/360 (7%)

Query: 5   MPEDTIPNGFVQNSVIAGSNNPPNTAAKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCE 64
           M  + IPNGF+QN +  G +NPP    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCE
Sbjct: 1   MAAEAIPNGFIQNPI--GGSNPP--TIKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCE 56

Query: 65  ICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGI 124
           ICGKGFQRDQNLQLHRRGHNLPWKLKQR+SKE RKRVYVCPEKTCVHHHPSRALGDLTGI
Sbjct: 57  ICGKGFQRDQNLQLHRRGHNLPWKLKQRSSKEPRKRVYVCPEKTCVHHHPSRALGDLTGI 116

Query: 125 KKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAF 184
           KKHFCRKHGEKKWKCEKCSKRYAVQSDWKAH+KTCGTREYKCDCGT+FSRRDSFITHRAF
Sbjct: 117 KKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHTKTCGTREYKCDCGTLFSRRDSFITHRAF 176

Query: 185 CDALAEETARVNAASSMNSLANGSISYHFMGTPLGPSVAQHFSSIFKPIPGGGADETIDQ 244
           CDALAEETARV AAS++N   NG+I+YHFMGT L PS+ QHFSSIFKPI     DE  DQ
Sbjct: 177 CDALAEETARVTAASNIN---NGTINYHFMGTSLAPSMPQHFSSIFKPISSN--DEATDQ 231

Query: 245 TRRGLSLWMAPGSQGHETVGSNLTEIQQL-GSVSSEAMYGD------HPPPSDYHFNWVF 297
           TRRGLSLWM  GSQGHET+G+NL EI QL  S+S  ++Y D      +PPPS Y  +WVF
Sbjct: 232 TRRGLSLWMGQGSQGHETMGTNLQEIHQLRSSMSPGSVYADPLVSCSNPPPSSYQLSWVF 291

Query: 298 GNNKQSSNNAAEAPAIASASLPLTGVKEAAATASHHHQLVSVNVPSLYSSQQQQTTTHQT 357
           G +KQSSNN  E    +S SLPL+ VKEAA +     Q+VS  VPSLYSSQ     +HQT
Sbjct: 292 G-SKQSSNN-TEDQLTSSTSLPLSNVKEAAGS-----QIVS--VPSLYSSQHH---SHQT 339




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|302143346|emb|CBI21907.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224132860|ref|XP_002327898.1| predicted protein [Populus trichocarpa] gi|222837307|gb|EEE75686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147819361|emb|CAN60170.1| hypothetical protein VITISV_003666 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356545021|ref|XP_003540944.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein MAGPIE-like [Glycine max] Back     alignment and taxonomy information
>gi|356546983|ref|XP_003541898.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein MAGPIE-like [Glycine max] Back     alignment and taxonomy information
>gi|356542167|ref|XP_003539541.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein MAGPIE-like [Glycine max] Back     alignment and taxonomy information
>gi|255553609|ref|XP_002517845.1| nucleic acid binding protein, putative [Ricinus communis] gi|223542827|gb|EEF44363.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356515128|ref|XP_003526253.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein NUTCRACKER-like [Glycine max] Back     alignment and taxonomy information
>gi|297848602|ref|XP_002892182.1| hypothetical protein ARALYDRAFT_470357 [Arabidopsis lyrata subsp. lyrata] gi|297338024|gb|EFH68441.1| hypothetical protein ARALYDRAFT_470357 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
TAIR|locus:2024193 506 MGP "AT1G03840" [Arabidopsis t 0.860 0.620 0.629 1e-100
TAIR|locus:2167608466 NUC "AT5G44160" [Arabidopsis t 0.608 0.476 0.753 1.6e-96
TAIR|locus:2101739452 IDD2 "AT3G50700" [Arabidopsis 0.490 0.396 0.827 2.4e-85
TAIR|locus:2173624 500 IDD1 "AT5G66730" [Arabidopsis 0.515 0.376 0.797 4.4e-84
TAIR|locus:2205672455 IDD7 "AT1G55110" [Arabidopsis 0.509 0.408 0.786 5e-83
TAIR|locus:2132397402 IDD12 "AT4G02670" [Arabidopsis 0.550 0.5 0.724 2.8e-82
TAIR|locus:2051688 516 IDD4 "indeterminate(ID)-domain 0.586 0.414 0.680 7.4e-82
TAIR|locus:2078262446 AT3G45260 "AT3G45260" [Arabido 0.520 0.426 0.745 1.2e-81
TAIR|locus:2143543 503 JKD "AT5G03150" [Arabidopsis t 0.490 0.355 0.806 1.5e-81
TAIR|locus:2204503467 AT1G14580 "AT1G14580" [Arabido 0.619 0.483 0.631 8.5e-81
TAIR|locus:2024193 MGP "AT1G03840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 999 (356.7 bits), Expect = 1.0e-100, P = 1.0e-100
 Identities = 211/335 (62%), Positives = 233/335 (69%)

Query:    23 SNNPPNTAAKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRG 82
             S NPP    KKKRNLPG PDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRG
Sbjct:    34 SLNPP--LVKKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRG 91

Query:    83 HNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKC 142
             HNLPWKLKQRTSKEVRKRVYVCPEK+CVHHHP+RALGDLTGIKKHFCRKHGEKKWKCEKC
Sbjct:    92 HNLPWKLKQRTSKEVRKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKC 151

Query:   143 SKRYAVQSDWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDALAEETARVNAASSMN 202
             +KRYAVQSDWKAHSKTCGTREY+CDCGT+FSRRDSFITHRAFCDALAEETAR+NAAS + 
Sbjct:   152 AKRYAVQSDWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDALAEETARLNAASHLK 211

Query:   203 SLAN--GS-ISYHF-MGTPL-GPSVAQHFSSIF-KPIPGGGADETIDQTRRGLSLW--MA 254
             S A   GS ++YH+ MGT +  PS+ Q  S  F  P P          T         M 
Sbjct:   212 SFAATAGSNLNYHYLMGTLIPSPSLPQPPSFPFGPPQPQHHHHHQFPITTNNFDHQDVMK 271

Query:   255 PGSQGHETVGSNLTEIQQLGSVSSEAMYGDHPPPSDYHFNWVFGN--NKQXXXXXXXXXX 312
             P S      G N+   QQ+ ++        H P  DY  NWVFGN  N            
Sbjct:   272 PASTLSLWSGGNINHHQQV-TIEDRMAPQPHSPQEDY--NWVFGNANNHGELITTSDSLI 328

Query:   313 XXXXXLPLTGVKEAAATASHHHQLVSVNVPSLYSS 347
                  + +   KE A  A+      S++VPSL+SS
Sbjct:   329 THDNNINIVQSKENANGAT------SLSVPSLFSS 357




GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2167608 NUC "AT5G44160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101739 IDD2 "AT3G50700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173624 IDD1 "AT5G66730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205672 IDD7 "AT1G55110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132397 IDD12 "AT4G02670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051688 IDD4 "indeterminate(ID)-domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078262 AT3G45260 "AT3G45260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143543 JKD "AT5G03150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204503 AT1G14580 "AT1G14580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZWA6MGP_ARATHNo assigned EC number0.60110.84650.6106yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00640208
hypothetical protein (479 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.94
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.85
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.74
KOG3576267 consensus Ovo and related transcription factors [T 99.73
KOG3608467 consensus Zn finger proteins [General function pre 99.65
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.65
KOG3576267 consensus Ovo and related transcription factors [T 99.56
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.54
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.48
KOG3608467 consensus Zn finger proteins [General function pre 99.42
PLN03086567 PRLI-interacting factor K; Provisional 99.3
PHA00733128 hypothetical protein 98.98
PHA00733128 hypothetical protein 98.96
PLN03086567 PRLI-interacting factor K; Provisional 98.94
KOG3993500 consensus Transcription factor (contains Zn finger 98.81
PHA0276855 hypothetical protein; Provisional 98.58
PHA0276855 hypothetical protein; Provisional 98.57
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.46
KOG3993500 consensus Transcription factor (contains Zn finger 98.25
PHA0061644 hypothetical protein 97.97
COG5189423 SFP1 Putative transcriptional repressor regulating 97.9
PHA0073279 hypothetical protein 97.85
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.82
PHA0061644 hypothetical protein 97.81
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.78
PHA0073279 hypothetical protein 97.65
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.61
COG5189423 SFP1 Putative transcriptional repressor regulating 97.35
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.31
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.24
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.16
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.11
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.9
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.84
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.71
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.71
COG5048467 FOG: Zn-finger [General function prediction only] 96.63
smart0035526 ZnF_C2H2 zinc finger. 96.54
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 96.41
KOG1146 1406 consensus Homeobox protein [General function predi 96.11
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.03
PRK04860160 hypothetical protein; Provisional 95.84
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.7
smart0035526 ZnF_C2H2 zinc finger. 95.48
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 95.24
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.74
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.66
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.21
PRK04860160 hypothetical protein; Provisional 94.17
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.82
COG5048467 FOG: Zn-finger [General function prediction only] 93.82
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.79
KOG1146 1406 consensus Homeobox protein [General function predi 93.59
COG5236493 Uncharacterized conserved protein, contains RING Z 93.46
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.19
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.76
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 91.74
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.11
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 90.51
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 90.16
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 88.93
KOG2893341 consensus Zn finger protein [General function pred 88.63
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 87.37
COG404965 Uncharacterized protein containing archaeal-type C 86.64
KOG2893341 consensus Zn finger protein [General function pred 86.03
PRK00464154 nrdR transcriptional regulator NrdR; Validated 84.56
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 84.56
KOG2186276 consensus Cell growth-regulating nucleolar protein 84.33
COG5236493 Uncharacterized conserved protein, contains RING Z 82.35
PHA0062659 hypothetical protein 80.91
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 80.71
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.94  E-value=3.3e-28  Score=219.40  Aligned_cols=134  Identities=23%  Similarity=0.419  Sum_probs=126.3

Q ss_pred             CcCCCCCCCCCCCCCchhhhhcCccccCC---CCceecccccccccChHhHHHHHHhcCCCcccccccccccCCceeeCC
Q 048287           29 TAAKKKRNLPGTPDPEAEVIALSPKTLMA---TNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCP  105 (365)
Q Consensus        29 ~~~~~~c~~c~~~~~~~~~l~~h~k~~~~---~k~~~C~~Cgk~F~~~~~L~~H~~~H~~~~~~~~~~~~~~~~k~~~C~  105 (365)
                      ....++|+.||+.+.+...|.+|+.+|-.   .+.+.|++|||.|.....|++|+|+|+               -+++|.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~---------------l~c~C~  191 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT---------------LPCECG  191 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC---------------CCcccc
Confidence            45588999999999999999999999854   688999999999999999999999996               468899


Q ss_pred             CCCccCCCCCCccCChhHHHHHHhhhcCCCccccccccccccchhhhhhhhcc-cCCcceecc-CCCccCChhHHHHHHH
Q 048287          106 EKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKT-CGTREYKCD-CGTVFSRRDSFITHRA  183 (365)
Q Consensus       106 ~C~C~~~~~~~~f~~~~~L~~H~~~H~~ekp~~C~~C~k~F~~~~~L~~H~~~-~~~kpy~C~-Cgk~F~~~~~L~~H~~  183 (365)
                      +|       ||.|...-.|..|+|+|+|||||.|..|+|.|..+++|+.|+++ .+.|+|.|. |+|.|++++.|.+|.+
T Consensus       192 iC-------GKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  192 IC-------GKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cc-------cccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            98       99999999999999999999999999999999999999999999 778999999 9999999999999987


Q ss_pred             H
Q 048287          184 F  184 (365)
Q Consensus       184 ~  184 (365)
                      .
T Consensus       265 S  265 (279)
T KOG2462|consen  265 S  265 (279)
T ss_pred             h
Confidence            6



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-08
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 57.8 bits (138), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 44/155 (28%), Positives = 70/155 (45%), Gaps = 24/155 (15%) Query: 45 AEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGH--NLPWK-------LKQRTSK 95 ++ +A +T + C CGK F ++L H+R H P+K QR + Sbjct: 34 SDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANL 93 Query: 96 EVRKRV------YVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQ 149 +R Y CPE C ++ L ++ H GEK +KC +C K ++ + Sbjct: 94 RAHQRTHTGEKPYACPE--C-----GKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSRE 146 Query: 150 SDWKAHSKT-CGTREYKC-DCGTVFSRRDSFITHR 182 + H +T G + YKC +CG FSRRD+ H+ Sbjct: 147 DNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQ 181
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-04
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 8e-04
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
 Score = 53.3 bits (129), Expect = 3e-09
 Identities = 33/128 (25%), Positives = 56/128 (43%), Gaps = 26/128 (20%)

Query: 61  FLCE--ICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRAL 118
           F+C    C K + +  +LQ+H R H          + E   + Y C  K C      R  
Sbjct: 7   FMCAYPGCNKRYFKLSHLQMHSRKH----------TGE---KPYQCDFKDC-----ERRF 48

Query: 119 GDLTGIKKHFCRKH-GEKKWKCEKCSKRYAVQSDWKAHSKT-CGTREYKC---DCGTVFS 173
                +K+H  R+H G K ++C+ C ++++     K H++T  G + + C    C   F+
Sbjct: 49  SRSDQLKRHQ-RRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFA 107

Query: 174 RRDSFITH 181
           R D  + H
Sbjct: 108 RSDELVRH 115


>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.91
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.82
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.81
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.75
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.75
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.73
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.72
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.71
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.7
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.7
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.7
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.69
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.69
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.66
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.63
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.63
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.61
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.6
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.59
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.58
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.57
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.55
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.55
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.53
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.5
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.5
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.49
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.48
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.48
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.45
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.44
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.44
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.44
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.43
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.4
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.38
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.38
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.37
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.37
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.37
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.36
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.36
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.35
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.33
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.31
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.3
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.3
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.3
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.29
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.28
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.25
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.24
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.21
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.18
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.18
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.14
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.12
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.1
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.1
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.03
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.03
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.98
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.97
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.97
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.96
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.95
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.95
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.95
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.95
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.94
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.94
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.94
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.93
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.93
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.92
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.91
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.9
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.89
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.87
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.87
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.87
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.87
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.87
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.86
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.85
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.85
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.84
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.83
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.83
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.82
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.81
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.8
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.79
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.77
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.76
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.76
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.75
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.75
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.75
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.75
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.75
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.74
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.74
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.72
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.72
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.72
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.71
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.71
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.71
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.68
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.68
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.67
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.66
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.65
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.64
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.59
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.58
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.54
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.52
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.47
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.41
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.38
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.38
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.32
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.27
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.21
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.15
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.15
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.13
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.13
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.12
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.12
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.06
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.02
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.99
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.99
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.98
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.97
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.97
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.95
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.95
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.94
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.93
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.16
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.92
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.88
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.88
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.87
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.87
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.84
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.04
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.82
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.82
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.81
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.01
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.8
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.79
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.76
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.74
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.71
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.7
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.69
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.68
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.68
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.67
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.66
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.62
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.62
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.62
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.61
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.61
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.65
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.63
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.47
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.46
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.57
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.39
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.36
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.05
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.99
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.96
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.44
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.73
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.7
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.68
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.38
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.82
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.71
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.24
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 85.59
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 84.9
2k5c_A95 Uncharacterized protein PF0385; structural genomic 83.47
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 82.61
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 82.03
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.94  E-value=1.6e-27  Score=209.98  Aligned_cols=143  Identities=27%  Similarity=0.538  Sum_probs=89.3

Q ss_pred             CCCCcCCCCCCCCCCCCCchhhhhcCccccCCCCceecccccccccChHhHHHHHHhcCCCcccccccccccCCceeeCC
Q 048287           26 PPNTAAKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCP  105 (365)
Q Consensus        26 ~~~~~~~~~c~~c~~~~~~~~~l~~h~k~~~~~k~~~C~~Cgk~F~~~~~L~~H~~~H~~~~~~~~~~~~~~~~k~~~C~  105 (365)
                      ....+++|+|+.|++.|.....|..|+++|.++++|.|++|++.|.....|..|++.|.             ++++|.|+
T Consensus        15 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-------------~~~~~~C~   81 (190)
T 2i13_A           15 LEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHT-------------GEKPYKCP   81 (190)
T ss_dssp             ----------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHH-------------CCCCEECT
T ss_pred             hcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcC-------------CCCCccCc
Confidence            34456789999999999999999999999999999999999999999999999999997             55566666


Q ss_pred             CCCccCCCCCCccCChhHHHHHHhhhcCCCccccccccccccchhhhhhhhcc-cCCcceecc-CCCccCChhHHHHHHH
Q 048287          106 EKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKT-CGTREYKCD-CGTVFSRRDSFITHRA  183 (365)
Q Consensus       106 ~C~C~~~~~~~~f~~~~~L~~H~~~H~~ekp~~C~~C~k~F~~~~~L~~H~~~-~~~kpy~C~-Cgk~F~~~~~L~~H~~  183 (365)
                      +|       ++.|.....|..|+++|+++++|.|+.|++.|.....|..|+++ +++++|.|+ |++.|.+...|..|++
T Consensus        82 ~C-------~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~  154 (190)
T 2i13_A           82 EC-------GKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQR  154 (190)
T ss_dssp             TT-------CCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHH
T ss_pred             cc-------CCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHH
Confidence            65       66666666666666666666666666666666666666666655 555566666 6666666666666666


Q ss_pred             Hhhhh
Q 048287          184 FCDAL  188 (365)
Q Consensus       184 ~h~~~  188 (365)
                      .|++.
T Consensus       155 ~H~~~  159 (190)
T 2i13_A          155 THTGE  159 (190)
T ss_dssp             HHHCC
T ss_pred             hcCCC
Confidence            55543



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 35.0 bits (80), Expect = 7e-04
 Identities = 13/51 (25%), Positives = 20/51 (39%), Gaps = 3/51 (5%)

Query: 134 EKKWKCEKCSKRYAVQSDWKAHSKTCGT-REYKCD-CGTVFSRRDSFITHR 182
           +K + C+ C K +  +S    H       R Y C  CG  F  +   + H 
Sbjct: 1   DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHM 50


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.47
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.45
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.06
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.04
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.96
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.92
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.91
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.89
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.87
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.78
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.76
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.76
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.75
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.75
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.74
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.71
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.7
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.67
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.64
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.61
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.6
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.52
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.52
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.51
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.45
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.42
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.39
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.38
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.35
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.34
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.29
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.25
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.21
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.21
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.18
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.16
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.13
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.08
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.01
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.97
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.9
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.52
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.49
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.44
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.43
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.42
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.29
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.29
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.23
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.12
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.1
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.95
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.92
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.86
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.85
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.85
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.81
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.78
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.77
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.74
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.71
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.69
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.54
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.53
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.42
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.41
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.39
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.27
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.27
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.22
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.18
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.17
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.07
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.05
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.03
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.93
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.84
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.79
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.75
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.26
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.24
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.11
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.04
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.01
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.55
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.0
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.79
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.61
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.28
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.22
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.65
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.62
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.83
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.5
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.38
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.71
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.62
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.37
d1y0jb136 U-shaped transcription factor, different fingers { 89.82
d1y0jb136 U-shaped transcription factor, different fingers { 89.67
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 87.11
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 85.96
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 85.5
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 84.48
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 84.22
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 80.41
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.47  E-value=1.8e-14  Score=98.63  Aligned_cols=53  Identities=21%  Similarity=0.345  Sum_probs=32.4

Q ss_pred             CCceecccccccccChHhHHHHHHhcCCCcccccccccccCCceeeCCCCCccCCCCCCccCChhHHHHHHhhh
Q 048287           58 TNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRK  131 (365)
Q Consensus        58 ~k~~~C~~Cgk~F~~~~~L~~H~~~H~~~~~~~~~~~~~~~~k~~~C~~C~C~~~~~~~~f~~~~~L~~H~~~H  131 (365)
                      +|+|+|+ ||+.|..+..|..|+++|+             +++||.|++|       ++.|.....|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht-------------~ekpy~C~~C-------~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHL-------------GLRPYGCGVC-------GKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHS-------------CCCSEECTTT-------SCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccc-------------cccCCcCCCc-------CCEecCHHHHHHHHhcC
Confidence            3566663 6666666666666666665             5666666665       66666666666666554



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure