Query         048295
Match_columns 80
No_of_seqs    41 out of 43
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 08:15:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048295.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048295hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12273 RCR:  Chitin synthesis  92.1   0.094   2E-06   35.4   1.6   25    8-32      2-26  (130)
  2 PF07172 GRP:  Glycine rich pro  82.6     1.4   3E-05   29.3   2.6   22    9-31      5-26  (95)
  3 PF11153 DUF2931:  Protein of u  71.9     2.9 6.4E-05   30.1   1.9   17   17-33      6-22  (216)
  4 PF15240 Pro-rich:  Proline-ric  66.5     3.3 7.2E-05   30.8   1.3   20   12-31      1-20  (179)
  5 PF15284 PAGK:  Phage-encoded v  60.6      14 0.00031   23.5   3.2   16   47-62     39-54  (61)
  6 PF13677 MotB_plug:  Membrane M  59.6     8.7 0.00019   23.1   2.0   22   10-31     24-45  (58)
  7 PF08139 LPAM_1:  Prokaryotic m  51.8      14 0.00031   19.6   1.8   16   13-28      9-24  (25)
  8 PRK10081 entericidin B membran  50.4      16 0.00034   22.2   2.1   20   13-32      8-27  (48)
  9 COG5510 Predicted small secret  49.8      16 0.00036   21.9   2.1   21   12-32      7-27  (44)
 10 PRK08944 motB flagellar motor   47.3      17 0.00036   28.3   2.3   22   10-31     24-45  (302)
 11 PLN03207 stomagen; Provisional  46.9      38 0.00082   23.8   3.8   19   19-37     21-39  (113)
 12 PRK14758 hypothetical protein;  46.5      20 0.00043   19.6   1.9   19    6-24      3-21  (27)
 13 PRK06742 flagellar motor prote  46.1      16 0.00035   26.9   2.0   23   10-32     19-41  (225)
 14 PRK08457 motB flagellar motor   44.4      17 0.00036   27.4   1.9   22   10-31     23-44  (257)
 15 PF09680 Tiny_TM_bacill:  Prote  40.1      29 0.00064   18.4   1.9   12   11-22      7-18  (24)
 16 PRK06667 motB flagellar motor   39.5      28  0.0006   25.9   2.4   22   10-31     25-46  (252)
 17 PRK13684 Ycf48-like protein; P  39.2      22 0.00047   27.2   1.8   20   12-31      9-28  (334)
 18 PRK06925 flagellar motor prote  39.1      30 0.00066   25.3   2.5   22   10-31     22-43  (230)
 19 PRK07734 motB flagellar motor   39.0      30 0.00065   25.8   2.5   22   10-31     26-47  (259)
 20 PF03032 Brevenin:  Brevenin/es  38.6      16 0.00036   21.6   0.9   19   13-31      7-25  (46)
 21 PRK09810 entericidin A; Provis  38.0      29 0.00064   20.3   1.9   15   18-32     10-24  (41)
 22 PRK06231 F0F1 ATP synthase sub  37.6      30 0.00065   25.2   2.3   21   10-30     11-31  (205)
 23 PRK06778 hypothetical protein;  36.8      34 0.00074   26.4   2.6   22   10-31     29-50  (289)
 24 PRK00442 tatA twin arginine tr  36.6      43 0.00092   22.6   2.7   14   14-27     10-23  (92)
 25 COG2834 LolA Outer membrane li  35.7      36 0.00078   24.4   2.4   23    9-31      4-26  (211)
 26 PF15347 PAG:  Phosphoprotein a  34.9      47   0.001   27.9   3.2   17   15-31     28-44  (428)
 27 PRK09038 flagellar motor prote  34.3      40 0.00086   25.7   2.6   22   10-31     24-45  (281)
 28 PF06404 PSK:  Phytosulfokine p  33.1      16 0.00034   23.7   0.2   17   19-35      4-20  (81)
 29 PRK09041 motB flagellar motor   32.6      43 0.00093   26.3   2.6   22   10-31     33-54  (317)
 30 TIGR02887 spore_ger_x_C germin  32.5      20 0.00044   27.2   0.7   16   16-31      7-22  (371)
 31 TIGR01742 SA_tandem_lipo Staph  31.5      28  0.0006   27.4   1.3   20    9-28      6-25  (255)
 32 PLN03023 Expansin-like B1; Pro  31.3      54  0.0012   25.3   2.9   33    9-41      2-37  (247)
 33 PF15102 TMEM154:  TMEM154 prot  30.8      45 0.00098   24.2   2.3    8   37-44     88-95  (146)
 34 TIGR00847 ccoS cytochrome oxid  30.7      55  0.0012   19.7   2.3   24    8-35      8-31  (51)
 35 TIGR03511 GldH_lipo gliding mo  30.5      53  0.0012   23.4   2.6   24   18-41     11-35  (156)
 36 TIGR01180 aman2_put alpha-1,2-  29.4      45 0.00097   28.2   2.3   20    9-28      6-25  (750)
 37 PRK11023 outer membrane lipopr  29.3      41 0.00088   24.1   1.8   12   17-28      9-20  (191)
 38 PRK02958 tatA twin arginine tr  29.1      74  0.0016   20.5   2.8   15   13-27      9-23  (73)
 39 PRK04561 tatA twin arginine tr  28.8      76  0.0016   20.8   2.9   15   13-27      9-23  (75)
 40 PRK03554 tatA twin arginine tr  28.7      74  0.0016   21.5   2.8   15   13-27      9-23  (89)
 41 PF03597 CcoS:  Cytochrome oxid  28.6      65  0.0014   18.8   2.3   24    8-35      7-30  (45)
 42 PRK04598 tatA twin arginine tr  26.6      86  0.0019   20.6   2.8   15   13-27      9-23  (81)
 43 PF06491 Disulph_isomer:  Disul  26.4      24 0.00052   25.5   0.2    8   59-66     91-98  (136)
 44 PF12911 OppC_N:  N-terminal TM  26.3      62  0.0013   18.2   1.9   10    9-18     16-25  (56)
 45 PRK12799 motB flagellar motor   26.2      62  0.0013   26.8   2.5   22   10-31     34-55  (421)
 46 COG3317 NlpB Uncharacterized l  25.9 1.4E+02  0.0029   24.5   4.4   53   12-65      5-58  (342)
 47 PRK05996 motB flagellar motor   25.5      64  0.0014   26.9   2.5   22   10-31     39-60  (423)
 48 PF14054 DUF4249:  Domain of un  25.5      35 0.00076   24.6   0.9   12   16-27      2-13  (298)
 49 TIGR01732 tiny_TM_bacill conse  25.4      82  0.0018   17.0   2.1   12   10-21      8-19  (26)
 50 PF11810 DUF3332:  Domain of un  24.8      73  0.0016   23.3   2.5   20   12-31      5-24  (176)
 51 COG3197 FixS Uncharacterized p  24.7      83  0.0018   19.8   2.4   19    8-26      8-26  (58)
 52 PRK11627 hypothetical protein;  24.4      70  0.0015   23.5   2.3   21   19-41     10-30  (192)
 53 TIGR02898 spore_YhcN_YlaJ spor  23.9      41  0.0009   24.2   1.0   16   16-31      4-19  (158)
 54 PF08693 SKG6:  Transmembrane a  23.3      57  0.0012   19.0   1.4   14    9-22     20-33  (40)
 55 PF13623 SurA_N_2:  SurA N-term  22.9      80  0.0017   22.1   2.3   26    2-27      2-27  (145)
 56 PRK00720 tatA twin arginine tr  22.8   1E+02  0.0022   20.2   2.6   11   17-27     13-23  (78)
 57 PRK01833 tatA twin arginine tr  21.5 1.3E+02  0.0027   19.5   2.8   15   13-27      9-23  (74)
 58 PRK03625 tatE twin arginine tr  20.7 1.3E+02  0.0028   19.1   2.7   15   13-27      9-23  (67)
 59 PF04507 DUF576:  Protein of un  20.1      35 0.00075   27.0   0.0   18   12-29      8-25  (257)

No 1  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=92.05  E-value=0.094  Score=35.39  Aligned_cols=25  Identities=24%  Similarity=0.538  Sum_probs=16.7

Q ss_pred             chHHHHHHHHHHHHHHhcccccccc
Q 048295            8 VPLMILLLWFIFIFITISHCHGSRS   32 (80)
Q Consensus         8 ~~~~~~lllllL~l~~~~~C~gaR~   32 (80)
                      ..|.+++|++|+++|++..|...|-
T Consensus         2 W~l~~iii~~i~l~~~~~~~~~rRR   26 (130)
T PF12273_consen    2 WVLFAIIIVAILLFLFLFYCHNRRR   26 (130)
T ss_pred             eeeHHHHHHHHHHHHHHHHHHHHHH
Confidence            3455666667777777888876663


No 2  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=82.57  E-value=1.4  Score=29.30  Aligned_cols=22  Identities=23%  Similarity=0.374  Sum_probs=9.6

Q ss_pred             hHHHHHHHHHHHHHHhccccccc
Q 048295            9 PLMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus         9 ~~~~~lllllL~l~~~~~C~gaR   31 (80)
                      .+.+|.|+|.++|+ +++=.++|
T Consensus         5 ~~llL~l~LA~lLl-isSevaa~   26 (95)
T PF07172_consen    5 AFLLLGLLLAALLL-ISSEVAAR   26 (95)
T ss_pred             HHHHHHHHHHHHHH-HHhhhhhH
Confidence            34333344444444 44444444


No 3  
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=71.92  E-value=2.9  Score=30.08  Aligned_cols=17  Identities=6%  Similarity=0.530  Sum_probs=10.5

Q ss_pred             HHHHHHHhccccccccc
Q 048295           17 FIFIFITISHCHGSRST   33 (80)
Q Consensus        17 llL~l~~~~~C~gaR~~   33 (80)
                      ++++++++.+|+.....
T Consensus         6 ~l~l~lll~~C~~~~~~   22 (216)
T PF11153_consen    6 LLLLLLLLTGCSTNPNE   22 (216)
T ss_pred             HHHHHHHHHhhcCCCcc
Confidence            33355568889866543


No 4  
>PF15240 Pro-rich:  Proline-rich
Probab=66.53  E-value=3.3  Score=30.85  Aligned_cols=20  Identities=15%  Similarity=0.411  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHhccccccc
Q 048295           12 ILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        12 ~~lllllL~l~~~~~C~gaR   31 (80)
                      ||||||-++||++||-..+.
T Consensus         1 MLlVLLSvALLALSSAQ~~d   20 (179)
T PF15240_consen    1 MLLVLLSVALLALSSAQSTD   20 (179)
T ss_pred             ChhHHHHHHHHHhhhccccc
Confidence            67777878888888876555


No 5  
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=60.64  E-value=14  Score=23.45  Aligned_cols=16  Identities=25%  Similarity=0.542  Sum_probs=12.8

Q ss_pred             CCcccccCCCCCCCCC
Q 048295           47 TGHFLGFLPRHFPIPS   62 (80)
Q Consensus        47 ~~~f~gfLPkg~piPP   62 (80)
                      ..++=..+|-|+++||
T Consensus        39 ~P~wC~lwP~g~~iP~   54 (61)
T PF15284_consen   39 KPVWCDLWPAGIPIPE   54 (61)
T ss_pred             CChHHhcCCCCCCCCc
Confidence            3447778899999997


No 6  
>PF13677 MotB_plug:  Membrane MotB of proton-channel complex MotA/MotB 
Probab=59.58  E-value=8.7  Score=23.11  Aligned_cols=22  Identities=32%  Similarity=0.579  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      ++++|+.||++++..+.-+..+
T Consensus        24 lmTLLl~fFVlL~s~s~~d~~k   45 (58)
T PF13677_consen   24 LMTLLLAFFVLLFSMSSVDKEK   45 (58)
T ss_pred             HHHHHHHHHHHHHHHHhCCHHH
Confidence            5678888888888887766544


No 7  
>PF08139 LPAM_1:  Prokaryotic membrane lipoprotein lipid attachment site;  InterPro: IPR012640  In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,].  This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=51.83  E-value=14  Score=19.58  Aligned_cols=16  Identities=13%  Similarity=0.515  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHhcccc
Q 048295           13 LLLWFIFIFITISHCH   28 (80)
Q Consensus        13 ~lllllL~l~~~~~C~   28 (80)
                      =+++.+++++.+++|.
T Consensus         9 kil~~l~a~~~LagCs   24 (25)
T PF08139_consen    9 KILFPLLALFMLAGCS   24 (25)
T ss_pred             HHHHHHHHHHHHhhcc
Confidence            3456666777788885


No 8  
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=50.44  E-value=16  Score=22.18  Aligned_cols=20  Identities=10%  Similarity=0.408  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHhcccccccc
Q 048295           13 LLLWFIFIFITISHCHGSRS   32 (80)
Q Consensus        13 ~lllllL~l~~~~~C~gaR~   32 (80)
                      +++.+++..+.++.|+-.++
T Consensus         8 ~i~~~l~~~~~l~~CnTv~G   27 (48)
T PRK10081          8 AIFSVLVLSTVLTACNTTRG   27 (48)
T ss_pred             HHHHHHHHHHHHhhhhhhhh
Confidence            33444455556899986663


No 9  
>COG5510 Predicted small secreted protein [Function unknown]
Probab=49.85  E-value=16  Score=21.86  Aligned_cols=21  Identities=14%  Similarity=0.406  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHhcccccccc
Q 048295           12 ILLLWFIFIFITISHCHGSRS   32 (80)
Q Consensus        12 ~~lllllL~l~~~~~C~gaR~   32 (80)
                      .+++++++.-+++..|+-.|+
T Consensus         7 l~i~~vll~s~llaaCNT~rG   27 (44)
T COG5510           7 LLIALVLLASTLLAACNTMRG   27 (44)
T ss_pred             HHHHHHHHHHHHHHHhhhhhc
Confidence            445555666777899988774


No 10 
>PRK08944 motB flagellar motor protein MotB; Reviewed
Probab=47.33  E-value=17  Score=28.27  Aligned_cols=22  Identities=27%  Similarity=0.514  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      +|.+|++||++||.++.-+...
T Consensus        24 lmTLLm~FFVlL~S~S~~d~~K   45 (302)
T PRK08944         24 LMSLLMCFFVLLLSFSEMDVLK   45 (302)
T ss_pred             HHHHHHHHHHHHHHHhhcCHHH
Confidence            6788999999999999887665


No 11 
>PLN03207 stomagen; Provisional
Probab=46.90  E-value=38  Score=23.81  Aligned_cols=19  Identities=21%  Similarity=0.499  Sum_probs=11.9

Q ss_pred             HHHHHhccccccccccccc
Q 048295           19 FIFITISHCHGSRSTNVFN   37 (80)
Q Consensus        19 L~l~~~~~C~gaR~~~~f~   37 (80)
                      .+|+..--|+|+|+.....
T Consensus        21 ~llla~~v~qgsr~~~~~~   39 (113)
T PLN03207         21 FLLLGAYVIQGSRNQSILP   39 (113)
T ss_pred             HHHHHHHHHhccccccccC
Confidence            3344445689999776643


No 12 
>PRK14758 hypothetical protein; Provisional
Probab=46.52  E-value=20  Score=19.57  Aligned_cols=19  Identities=16%  Similarity=0.291  Sum_probs=13.9

Q ss_pred             ccchHHHHHHHHHHHHHHh
Q 048295            6 RRVPLMILLLWFIFIFITI   24 (80)
Q Consensus         6 ~r~~~~~~lllllL~l~~~   24 (80)
                      +|+++-++|+++++.-++.
T Consensus         3 ~RYrFEliLivlIlCalia   21 (27)
T PRK14758          3 GRYRFEFILIILILCALIA   21 (27)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            5888888888777765543


No 13 
>PRK06742 flagellar motor protein MotS; Reviewed
Probab=46.11  E-value=16  Score=26.89  Aligned_cols=23  Identities=26%  Similarity=0.455  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHhcccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSRS   32 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR~   32 (80)
                      ++.+||.||++|+..+.-+..+-
T Consensus        19 m~TLLL~FFVlL~s~S~vd~~k~   41 (225)
T PRK06742         19 LTMLLLTFFVLLVATSKQDAVKL   41 (225)
T ss_pred             HHHHHHHHHHHHHHHhhcCHHHH
Confidence            56788889999998888877663


No 14 
>PRK08457 motB flagellar motor protein MotB; Reviewed
Probab=44.40  E-value=17  Score=27.36  Aligned_cols=22  Identities=23%  Similarity=0.392  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      +|.+||.||++|+..+.-+...
T Consensus        23 l~TLLL~FFVlL~smS~vd~~K   44 (257)
T PRK08457         23 FLSLLLALFIALYAISAVNKAK   44 (257)
T ss_pred             HHHHHHHHHHHHHHHHhcCHHH
Confidence            5788889999999888887665


No 15 
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=40.08  E-value=29  Score=18.44  Aligned_cols=12  Identities=25%  Similarity=0.794  Sum_probs=5.0

Q ss_pred             HHHHHHHHHHHH
Q 048295           11 MILLLWFIFIFI   22 (80)
Q Consensus        11 ~~~lllllL~l~   22 (80)
                      .+++++++|++.
T Consensus         7 alivVLFILLiI   18 (24)
T PF09680_consen    7 ALIVVLFILLII   18 (24)
T ss_pred             hhHHHHHHHHHH
Confidence            344444444433


No 16 
>PRK06667 motB flagellar motor protein MotB; Validated
Probab=39.50  E-value=28  Score=25.87  Aligned_cols=22  Identities=23%  Similarity=0.457  Sum_probs=17.5

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      ++.+||.||++|+..+.-+..+
T Consensus        25 l~TLLL~FFVlL~smS~~d~~k   46 (252)
T PRK06667         25 MVTLLLCFFVMLFTTNDVDENV   46 (252)
T ss_pred             HHHHHHHHHHHHHHhhhcCHHH
Confidence            5678888888888888887665


No 17 
>PRK13684 Ycf48-like protein; Provisional
Probab=39.18  E-value=22  Score=27.20  Aligned_cols=20  Identities=25%  Similarity=0.539  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHhccccccc
Q 048295           12 ILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        12 ~~lllllL~l~~~~~C~gaR   31 (80)
                      .-|+|+++++++++.|..+|
T Consensus         9 ~~~~~~~~~~~~~~~~~~~~   28 (334)
T PRK13684          9 KNLLLLLALLLVLSGCSTTR   28 (334)
T ss_pred             HHHHHHHHHHhhccccCCCC
Confidence            34566667777899998876


No 18 
>PRK06925 flagellar motor protein MotS; Reviewed
Probab=39.10  E-value=30  Score=25.32  Aligned_cols=22  Identities=23%  Similarity=0.591  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      ++.+|+.||++|+.++.-+..+
T Consensus        22 ~~TlLlafFvlL~s~s~~d~~k   43 (230)
T PRK06925         22 LITLILVFFILLFSMSQIDAQK   43 (230)
T ss_pred             HHHHHHHHHHHHHHhhcCCHHH
Confidence            5778888888898888877554


No 19 
>PRK07734 motB flagellar motor protein MotB; Reviewed
Probab=39.01  E-value=30  Score=25.79  Aligned_cols=22  Identities=23%  Similarity=0.507  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      ++.+|+.||++|+.++.-+..+
T Consensus        26 ~vTlLlaFFvlL~s~s~~d~~k   47 (259)
T PRK07734         26 LLTLLLALFIVLFAMSSIDAAK   47 (259)
T ss_pred             HHHHHHHHHHHHHHHhhCCHHH
Confidence            5678888888888888876554


No 20 
>PF03032 Brevenin:  Brevenin/esculentin/gaegurin/rugosin family;  InterPro: IPR004275 In addition to the highly specific cell-mediated immune system, vertebrates possess an efficient host-defence mechanism against invading microorganisms which involves the synthesis of highly potent antimicrobial peptides with a large spectrum of activity. This entry represents a number of these defence peptides secreted from the skin of amphibians, including the opiate-like dermorphins and deltorphins, and the antimicrobial dermoseptins and temporins.; GO: 0006952 defense response, 0042742 defense response to bacterium, 0005576 extracellular region
Probab=38.59  E-value=16  Score=21.64  Aligned_cols=19  Identities=42%  Similarity=0.688  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHhccccccc
Q 048295           13 LLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        13 ~lllllL~l~~~~~C~gaR   31 (80)
                      ++|+|||=++.++-|.--|
T Consensus         7 llLlfflG~ISlSlCeeEr   25 (46)
T PF03032_consen    7 LLLLFFLGTISLSLCEEER   25 (46)
T ss_pred             HHHHHHHHHcccchHHHhc
Confidence            4566667777889997555


No 21 
>PRK09810 entericidin A; Provisional
Probab=38.01  E-value=29  Score=20.26  Aligned_cols=15  Identities=13%  Similarity=0.445  Sum_probs=9.9

Q ss_pred             HHHHHHhcccccccc
Q 048295           18 IFIFITISHCHGSRS   32 (80)
Q Consensus        18 lL~l~~~~~C~gaR~   32 (80)
                      ++.++.++.|+-.++
T Consensus        10 ~~~~~~L~aCNTv~G   24 (41)
T PRK09810         10 LLASTLLTGCNTARG   24 (41)
T ss_pred             HHHHHHHhhhhhccc
Confidence            344556899986663


No 22 
>PRK06231 F0F1 ATP synthase subunit B; Validated
Probab=37.62  E-value=30  Score=25.24  Aligned_cols=21  Identities=24%  Similarity=0.567  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHhcccccc
Q 048295           10 LMILLLWFIFIFITISHCHGS   30 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~ga   30 (80)
                      +.++++.++++..++.||++-
T Consensus        11 ~~~~~~~~~~~~~~~~~~~~~   31 (205)
T PRK06231         11 LLLLSFSFLIISLFLVSCTEN   31 (205)
T ss_pred             HHHHHHHHHHHHHHHHHccCC
Confidence            444445566677788999865


No 23 
>PRK06778 hypothetical protein; Validated
Probab=36.82  E-value=34  Score=26.39  Aligned_cols=22  Identities=5%  Similarity=0.265  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      ++.+|+.||++|+..+.-+...
T Consensus        29 ~~TLLLaFFVlL~smS~vd~~k   50 (289)
T PRK06778         29 FTLAMMALFMVLWIVNSVSKSE   50 (289)
T ss_pred             HHHHHHHHHHHHHHhhcCCHHH
Confidence            5778888888999888876554


No 24 
>PRK00442 tatA twin arginine translocase protein A; Provisional
Probab=36.62  E-value=43  Score=22.60  Aligned_cols=14  Identities=0%  Similarity=0.294  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHhccc
Q 048295           14 LLWFIFIFITISHC   27 (80)
Q Consensus        14 lllllL~l~~~~~C   27 (80)
                      |++++++++++|.-
T Consensus        10 liIlvIvlllFG~~   23 (92)
T PRK00442         10 IVILVVVVLVFGTK   23 (92)
T ss_pred             HHHHHHHHHHhCcc
Confidence            33334445556654


No 25 
>COG2834 LolA Outer membrane lipoprotein-sorting protein [Cell envelope biogenesis, outer membrane]
Probab=35.66  E-value=36  Score=24.43  Aligned_cols=23  Identities=26%  Similarity=0.488  Sum_probs=14.9

Q ss_pred             hHHHHHHHHHHHHHHhccccccc
Q 048295            9 PLMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus         9 ~~~~~lllllL~l~~~~~C~gaR   31 (80)
                      ..+.+++++++.+++++.|..+-
T Consensus         4 ~~~~~~~~~~l~~~f~~~~~~~~   26 (211)
T COG2834           4 MMMKLLLALALLLLFLSACAQAG   26 (211)
T ss_pred             HHHHHHHHHHHHHHHhhhhhhhh
Confidence            44455666667777788886443


No 26 
>PF15347 PAG:  Phosphoprotein associated with glycosphingolipid-enriched
Probab=34.87  E-value=47  Score=27.94  Aligned_cols=17  Identities=24%  Similarity=0.544  Sum_probs=11.3

Q ss_pred             HHHHHHHHHhccccccc
Q 048295           15 LWFIFIFITISHCHGSR   31 (80)
Q Consensus        15 llllL~l~~~~~C~gaR   31 (80)
                      ||+-+++|++++|++-.
T Consensus        28 ~lis~LifLCsSC~reK   44 (428)
T PF15347_consen   28 LLISFLIFLCSSCDREK   44 (428)
T ss_pred             HHHHHHHHHhhcccccc
Confidence            33446677789997654


No 27 
>PRK09038 flagellar motor protein MotD; Reviewed
Probab=34.32  E-value=40  Score=25.68  Aligned_cols=22  Identities=23%  Similarity=0.493  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      ++.+|+.||++|+.++.-+..+
T Consensus        24 ~mTLLlaFFVlL~smS~~d~~k   45 (281)
T PRK09038         24 FITLLFAFFVVMYAISSVNEGK   45 (281)
T ss_pred             HHHHHHHHHHHHHHHhcCCHHH
Confidence            5678888888888888776554


No 28 
>PF06404 PSK:  Phytosulfokine precursor protein (PSK);  InterPro: IPR009438 This family consists of several plant specific phytosulfokine precursor proteins. Phytosulfokines, are active as either a pentapeptide or a C-terminally truncated tetrapeptide. These compounds were first isolated because of their ability to stimulate cell division in somatic embryo cultures of Asparagus officinalis [].; GO: 0008083 growth factor activity, 0008283 cell proliferation, 0005576 extracellular region
Probab=33.06  E-value=16  Score=23.72  Aligned_cols=17  Identities=6%  Similarity=0.149  Sum_probs=9.5

Q ss_pred             HHHHHhccccccccccc
Q 048295           19 FIFITISHCHGSRSTNV   35 (80)
Q Consensus        19 L~l~~~~~C~gaR~~~~   35 (80)
                      |+++++....|+|..-.
T Consensus         4 L~~~~~~~~~AARp~p~   20 (81)
T PF06404_consen    4 LLCSSSTSAAAARPLPA   20 (81)
T ss_pred             HHHHHhhHhhhcCCCCC
Confidence            33344455679995433


No 29 
>PRK09041 motB flagellar motor protein MotB; Validated
Probab=32.63  E-value=43  Score=26.34  Aligned_cols=22  Identities=14%  Similarity=0.347  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      ++.+|+.||++|+.++.-+..+
T Consensus        33 ~vTLLLaFFVlL~smS~vD~~k   54 (317)
T PRK09041         33 FMTAMMAFFLVMWLLSSSTPEQ   54 (317)
T ss_pred             HHHHHHHHHHHHHHHhcCCHHH
Confidence            5678888888888888876554


No 30 
>TIGR02887 spore_ger_x_C germination protein, Ger(x)C family. Members of this protein family are restricted to endospore-forming members of the Firmicutes lineage of bacteria, including the genera Bacillus, Clostridium, Thermoanaerobacter, Carboxydothermus, etc. Members are nearly all predicted lipoproteins and belong to probable transport operons, some of which have been characterized as crucial to germination in response to alanine. Members typically have been gene symbols gerKC, gerAC, gerYC, etc.
Probab=32.52  E-value=20  Score=27.22  Aligned_cols=16  Identities=19%  Similarity=0.613  Sum_probs=10.1

Q ss_pred             HHHHHHHHhccccccc
Q 048295           16 WFIFIFITISHCHGSR   31 (80)
Q Consensus        16 lllL~l~~~~~C~gaR   31 (80)
                      +++++++++++|...|
T Consensus         7 ~ll~~~~lLtGCwd~~   22 (371)
T TIGR02887         7 LLLLALLLLTGCWDSR   22 (371)
T ss_pred             HHHHHHHHHCCcCcHH
Confidence            3444555579997666


No 31 
>TIGR01742 SA_tandem_lipo Staphylococcus tandem lipoproteins. Members of this family are predicted lipoproteins (mostly), found in Staphylococcus aureus in several different tandem clusters in pathogenicity islands. Members are also found, clustered, in Staphylococcus epidermidis.
Probab=31.46  E-value=28  Score=27.40  Aligned_cols=20  Identities=15%  Similarity=0.354  Sum_probs=12.3

Q ss_pred             hHHHHHHHHHHHHHHhcccc
Q 048295            9 PLMILLLWFIFIFITISHCH   28 (80)
Q Consensus         9 ~~~~~lllllL~l~~~~~C~   28 (80)
                      ++.+.+.+++|.+.++++|.
T Consensus         6 kl~l~i~~~il~I~~i~GC~   25 (255)
T TIGR01742         6 KIALYISALILIISFVVGCG   25 (255)
T ss_pred             HHHHHHHHHHHHheeeeccc
Confidence            45444555555555789996


No 32 
>PLN03023 Expansin-like B1; Provisional
Probab=31.29  E-value=54  Score=25.29  Aligned_cols=33  Identities=18%  Similarity=0.338  Sum_probs=17.5

Q ss_pred             hHHHHHHHHHHHHHHhccccccc---cccccccCCC
Q 048295            9 PLMILLLWFIFIFITISHCHGSR---STNVFNLTPN   41 (80)
Q Consensus         9 ~~~~~lllllL~l~~~~~C~gaR---~~~~f~~~P~   41 (80)
                      ++.+++++|++++++.+.+.+.+   ...+|+..|.
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~W~~a~AT~Yg~~~   37 (247)
T PLN03023          2 PLSHYCCFLCVIVLLPLLCKSQDFTYSRATYYGSPD   37 (247)
T ss_pred             CchhhHHHHHHHHHhhhhhhcCCcccceEEEeCCCC
Confidence            44455555555555444333332   4567887775


No 33 
>PF15102 TMEM154:  TMEM154 protein family
Probab=30.80  E-value=45  Score=24.18  Aligned_cols=8  Identities=25%  Similarity=0.343  Sum_probs=3.5

Q ss_pred             ccCCCCCC
Q 048295           37 NLTPNSPH   44 (80)
Q Consensus        37 ~~~P~~~~   44 (80)
                      |..|.+++
T Consensus        88 K~~~ss~g   95 (146)
T PF15102_consen   88 KQEPSSQG   95 (146)
T ss_pred             CCCCcccc
Confidence            33444444


No 34 
>TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type. CcoS from Rhodobacter capsulatus has been shown essential for incorporation of redox-active prosthetic groups (heme, Cu) into cytochrome cbb(3) oxidase. FixS of Bradyrhizobium japonicum appears to have the same function. Members of this family are found so far in organisms with a cbb3-type cytochrome oxidase, including Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Caulobacter crescentus, Bradyrhizobium japonicum, and Rhodobacter capsulatus.
Probab=30.66  E-value=55  Score=19.75  Aligned_cols=24  Identities=17%  Similarity=0.175  Sum_probs=13.5

Q ss_pred             chHHHHHHHHHHHHHHhccccccccccc
Q 048295            8 VPLMILLLWFIFIFITISHCHGSRSTNV   35 (80)
Q Consensus         8 ~~~~~~lllllL~l~~~~~C~gaR~~~~   35 (80)
                      |++++++.++++..|++    |.|++|.
T Consensus         8 IpiSl~l~~~~l~~f~W----avk~GQf   31 (51)
T TIGR00847         8 IPISLLLGGVGLVAFLW----SLKSGQY   31 (51)
T ss_pred             HHHHHHHHHHHHHHHHH----HHccCCC
Confidence            45556666666666655    4555554


No 35 
>TIGR03511 GldH_lipo gliding motility-associated lipoprotein GldH. Members of this protein family are predicted lipoproteins, exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). Members include GldH, a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family may have gliding motility.
Probab=30.50  E-value=53  Score=23.45  Aligned_cols=24  Identities=13%  Similarity=0.281  Sum_probs=14.5

Q ss_pred             HHHHHHhccccccc-cccccccCCC
Q 048295           18 IFIFITISHCHGSR-STNVFNLTPN   41 (80)
Q Consensus        18 lL~l~~~~~C~gaR-~~~~f~~~P~   41 (80)
                      +++.+++.+|+..+ -.-.++.-|.
T Consensus        11 ll~~~ll~sC~~~~~vy~~y~~~p~   35 (156)
T TIGR03511        11 FLGACVLVSCTENTDVYHSYQSTPH   35 (156)
T ss_pred             HHHHHHhcccCCCCeEEEEeeECCc
Confidence            34445677999888 4444444454


No 36 
>TIGR01180 aman2_put alpha-1,2-mannosidase, putative. The identification of members of this family as putative alpha-1,2-mannosidases is based on an unpublished characterization of the aman2 gene in Bacillus sp. M-90 by Maruyama,Y., Nakajima,M. and Nakajima,T. Most members of this family appear to have signal sequences. Members from the dental pathogen Porphyromonas gingivalis have been described as immunoreactive with periodontitis patient serum.
Probab=29.37  E-value=45  Score=28.16  Aligned_cols=20  Identities=15%  Similarity=0.531  Sum_probs=14.6

Q ss_pred             hHHHHHHHHHHHHHHhcccc
Q 048295            9 PLMILLLWFIFIFITISHCH   28 (80)
Q Consensus         9 ~~~~~lllllL~l~~~~~C~   28 (80)
                      +|.|.++.+++.+++++.|.
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~   25 (750)
T TIGR01180         6 PILYIVLIFAILCLFVGRAL   25 (750)
T ss_pred             chHHHHHHHHHHHHHHhhhc
Confidence            67777776777777788884


No 37 
>PRK11023 outer membrane lipoprotein; Provisional
Probab=29.32  E-value=41  Score=24.13  Aligned_cols=12  Identities=8%  Similarity=0.373  Sum_probs=6.9

Q ss_pred             HHHHHHHhcccc
Q 048295           17 FIFIFITISHCH   28 (80)
Q Consensus        17 llL~l~~~~~C~   28 (80)
                      +++.++++++|.
T Consensus         9 ~l~~~~~l~gC~   20 (191)
T PRK11023          9 VLLSALLLQGCV   20 (191)
T ss_pred             HHHHHHHHhccH
Confidence            333445578895


No 38 
>PRK02958 tatA twin arginine translocase protein A; Provisional
Probab=29.06  E-value=74  Score=20.50  Aligned_cols=15  Identities=7%  Similarity=0.310  Sum_probs=7.7

Q ss_pred             HHHHHHHHHHHhccc
Q 048295           13 LLLWFIFIFITISHC   27 (80)
Q Consensus        13 ~lllllL~l~~~~~C   27 (80)
                      ++++++++++++|.-
T Consensus         9 lliIl~IvlllFG~k   23 (73)
T PRK02958          9 WLIVLVIVVLVFGTK   23 (73)
T ss_pred             HHHHHHHHHHHhCcc
Confidence            344444555556654


No 39 
>PRK04561 tatA twin arginine translocase protein A; Provisional
Probab=28.84  E-value=76  Score=20.79  Aligned_cols=15  Identities=7%  Similarity=0.330  Sum_probs=7.6

Q ss_pred             HHHHHHHHHHHhccc
Q 048295           13 LLLWFIFIFITISHC   27 (80)
Q Consensus        13 ~lllllL~l~~~~~C   27 (80)
                      ++++++++++++|.-
T Consensus         9 llIIlvIvlLlFG~~   23 (75)
T PRK04561          9 WLVVLVIVLLVFGTK   23 (75)
T ss_pred             HHHHHHHHHHHhCCc
Confidence            344444555556654


No 40 
>PRK03554 tatA twin arginine translocase protein A; Provisional
Probab=28.67  E-value=74  Score=21.47  Aligned_cols=15  Identities=13%  Similarity=0.308  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHHhccc
Q 048295           13 LLLWFIFIFITISHC   27 (80)
Q Consensus        13 ~lllllL~l~~~~~C   27 (80)
                      ++++++++++++|.-
T Consensus         9 LlIIlvIvLLlFG~k   23 (89)
T PRK03554          9 LLIIAVIVVLLFGTK   23 (89)
T ss_pred             HHHHHHHHHHHhCcc
Confidence            444444555556654


No 41 
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=28.62  E-value=65  Score=18.83  Aligned_cols=24  Identities=13%  Similarity=0.234  Sum_probs=13.2

Q ss_pred             chHHHHHHHHHHHHHHhccccccccccc
Q 048295            8 VPLMILLLWFIFIFITISHCHGSRSTNV   35 (80)
Q Consensus         8 ~~~~~~lllllL~l~~~~~C~gaR~~~~   35 (80)
                      +++++++.++++..|++    |.|++|.
T Consensus         7 ip~sl~l~~~~l~~f~W----avk~GQf   30 (45)
T PF03597_consen    7 IPVSLILGLIALAAFLW----AVKSGQF   30 (45)
T ss_pred             HHHHHHHHHHHHHHHHH----HHccCCC
Confidence            35555555555666655    4555553


No 42 
>PRK04598 tatA twin arginine translocase protein A; Provisional
Probab=26.56  E-value=86  Score=20.60  Aligned_cols=15  Identities=13%  Similarity=0.308  Sum_probs=7.6

Q ss_pred             HHHHHHHHHHHhccc
Q 048295           13 LLLWFIFIFITISHC   27 (80)
Q Consensus        13 ~lllllL~l~~~~~C   27 (80)
                      ++++++++++++|.-
T Consensus         9 lliIlvivlllFG~k   23 (81)
T PRK04598          9 LLIIAVIVVLLFGTK   23 (81)
T ss_pred             HHHHHHHHHHHhCcc
Confidence            444444555556644


No 43 
>PF06491 Disulph_isomer:  Disulphide isomerase;  InterPro: IPR009474 This entry consists of several hypothetical bacterial proteins of unknown function.; PDB: 3FHK_F.
Probab=26.35  E-value=24  Score=25.49  Aligned_cols=8  Identities=63%  Similarity=1.136  Sum_probs=4.1

Q ss_pred             CCCCCCCC
Q 048295           59 PIPSSGPS   66 (80)
Q Consensus        59 piPPSgPS   66 (80)
                      +.|||.||
T Consensus        91 ~~pPSSPS   98 (136)
T PF06491_consen   91 PYPPSSPS   98 (136)
T ss_dssp             TS---SSE
T ss_pred             CCCCCCch
Confidence            57999998


No 44 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=26.35  E-value=62  Score=18.21  Aligned_cols=10  Identities=20%  Similarity=0.341  Sum_probs=4.3

Q ss_pred             hHHHHHHHHH
Q 048295            9 PLMILLLWFI   18 (80)
Q Consensus         9 ~~~~~lllll   18 (80)
                      ++.++-++++
T Consensus        16 k~a~~gl~il   25 (56)
T PF12911_consen   16 KLAVIGLIIL   25 (56)
T ss_pred             chHHHHHHHH
Confidence            4444444333


No 45 
>PRK12799 motB flagellar motor protein MotB; Reviewed
Probab=26.19  E-value=62  Score=26.82  Aligned_cols=22  Identities=9%  Similarity=0.288  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      ++.+++.|||+|++++.-+...
T Consensus        34 fvTlLMAFFlLLwsmSsvd~~k   55 (421)
T PRK12799         34 FMTAMMAFFLVMWLLAVSSPQE   55 (421)
T ss_pred             HHHHHHHHHHHHHHhhcCCHHH
Confidence            5678888888888888876443


No 46 
>COG3317 NlpB Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=25.87  E-value=1.4e+02  Score=24.55  Aligned_cols=53  Identities=9%  Similarity=0.024  Sum_probs=29.3

Q ss_pred             HHHHHHHHHHHHhcccc-ccccccccccCCCCCCCCCCcccccCCCCCCCCCCCC
Q 048295           12 ILLLWFIFIFITISHCH-GSRSTNVFNLTPNSPHQQTGHFLGFLPRHFPIPSSGP   65 (80)
Q Consensus        12 ~~lllllL~l~~~~~C~-gaR~~~~f~~~P~~~~~~~~~f~gfLPkg~piPPSgP   65 (80)
                      .-+++.++++..++.|. ..+..+.++-.=++.. +..++-=-+|.||.-|.-.|
T Consensus         5 ~~~v~~al~v~~LaaCSs~~~~~~q~~d~qsyl~-A~~l~~l~~P~Gv~lp~~d~   58 (342)
T COG3317           5 AKLVLGALLVLLLAACSSDSEYKRQVSDDQSYLE-ARPLPPLEAPAGVILPQQDG   58 (342)
T ss_pred             HHHHHHHHHHHHHhhccCCcccccccccchhhhc-ccCCCCccCCCCcccCCCCC
Confidence            44555556666677776 7776666544222211 24455555677766565444


No 47 
>PRK05996 motB flagellar motor protein MotB; Validated
Probab=25.47  E-value=64  Score=26.89  Aligned_cols=22  Identities=14%  Similarity=0.351  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHhccccccc
Q 048295           10 LMILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        10 ~~~~lllllL~l~~~~~C~gaR   31 (80)
                      +|.+|+.|||+|++++.-+...
T Consensus        39 ~mt~lm~fFl~l~~~~~~~~~~   60 (423)
T PRK05996         39 FMTAMMAFFLVMWLINAANEET   60 (423)
T ss_pred             HHHHHHHHHHHHHHHhccCHHH
Confidence            6788888889999888887544


No 48 
>PF14054 DUF4249:  Domain of unknown function (DUF4249)
Probab=25.45  E-value=35  Score=24.64  Aligned_cols=12  Identities=17%  Similarity=0.797  Sum_probs=8.1

Q ss_pred             HHHHHHHHhccc
Q 048295           16 WFIFIFITISHC   27 (80)
Q Consensus        16 lllL~l~~~~~C   27 (80)
                      +++++++++.+|
T Consensus         2 ~l~ll~l~l~sC   13 (298)
T PF14054_consen    2 LLLLLLLLLSSC   13 (298)
T ss_pred             hHHHHHHHHhcc
Confidence            455566667888


No 49 
>TIGR01732 tiny_TM_bacill conserved hypothetical tiny transmembrane protein. This model represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=25.43  E-value=82  Score=17.01  Aligned_cols=12  Identities=17%  Similarity=0.714  Sum_probs=4.8

Q ss_pred             HHHHHHHHHHHH
Q 048295           10 LMILLLWFIFIF   21 (80)
Q Consensus        10 ~~~~lllllL~l   21 (80)
                      +.+++++++|++
T Consensus         8 f~livVLFILLI   19 (26)
T TIGR01732         8 FALIVVLFILLV   19 (26)
T ss_pred             hHHHHHHHHHHH
Confidence            334444444333


No 50 
>PF11810 DUF3332:  Domain of unknown function (DUF3332);  InterPro: IPR021768  This family of proteins are functionally uncharacterised. This family is only found in bacteria. 
Probab=24.75  E-value=73  Score=23.32  Aligned_cols=20  Identities=20%  Similarity=0.212  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHhccccccc
Q 048295           12 ILLLWFIFIFITISHCHGSR   31 (80)
Q Consensus        12 ~~lllllL~l~~~~~C~gaR   31 (80)
                      +.++.+++....+++|-|+=
T Consensus         5 ~~~~~~~~~~~~lsgC~Gsf   24 (176)
T PF11810_consen    5 KAAVALLAGSLSLSGCMGSF   24 (176)
T ss_pred             HHHHHHHHHHHHhccccccH
Confidence            44444555566789998765


No 51 
>COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism]
Probab=24.67  E-value=83  Score=19.78  Aligned_cols=19  Identities=21%  Similarity=0.053  Sum_probs=14.6

Q ss_pred             chHHHHHHHHHHHHHHhcc
Q 048295            8 VPLMILLLWFIFIFITISH   26 (80)
Q Consensus         8 ~~~~~~lllllL~l~~~~~   26 (80)
                      +++++++.++.+..|+++-
T Consensus         8 ipvsi~l~~v~l~~flWav   26 (58)
T COG3197           8 IPVSILLGAVGLGAFLWAV   26 (58)
T ss_pred             HHHHHHHHHHHHHHHHHhc
Confidence            5777888888888887764


No 52 
>PRK11627 hypothetical protein; Provisional
Probab=24.42  E-value=70  Score=23.50  Aligned_cols=21  Identities=14%  Similarity=0.542  Sum_probs=13.6

Q ss_pred             HHHHHhccccccccccccccCCC
Q 048295           19 FIFITISHCHGSRSTNVFNLTPN   41 (80)
Q Consensus        19 L~l~~~~~C~gaR~~~~f~~~P~   41 (80)
                      +.++++.+|.+.  .++....|+
T Consensus        10 ~a~~~L~gCA~~--p~~l~l~P~   30 (192)
T PRK11627         10 VALFMLAGCATP--SNTLEVSPK   30 (192)
T ss_pred             HHHHHHHhhcCC--CCEEEeCCc
Confidence            334557889866  366666776


No 53 
>TIGR02898 spore_YhcN_YlaJ sporulation lipoprotein, YhcN/YlaJ family. YhcN and YlaJ are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic 40-residue C-terminal domain that is not included in the seed alignment for this model. A portion of the low-complexity region between the lipoprotein signal sequence and the main conserved region of the protein family was also excised from the seed alignment.
Probab=23.92  E-value=41  Score=24.15  Aligned_cols=16  Identities=6%  Similarity=0.598  Sum_probs=8.7

Q ss_pred             HHHHHHHHhccccccc
Q 048295           16 WFIFIFITISHCHGSR   31 (80)
Q Consensus        16 lllL~l~~~~~C~gaR   31 (80)
                      +++++++++++|.-+.
T Consensus         4 ~~~~~~~~l~gC~~~~   19 (158)
T TIGR02898         4 IILLLLLVLTGCTNAQ   19 (158)
T ss_pred             HHHHHHHHHhhccccc
Confidence            3344444568886444


No 54 
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=23.34  E-value=57  Score=18.99  Aligned_cols=14  Identities=7%  Similarity=0.334  Sum_probs=6.9

Q ss_pred             hHHHHHHHHHHHHH
Q 048295            9 PLMILLLWFIFIFI   22 (80)
Q Consensus         9 ~~~~~lllllL~l~   22 (80)
                      |+..+.++|+++|+
T Consensus        20 PV~vI~~vl~~~l~   33 (40)
T PF08693_consen   20 PVGVIIIVLGAFLF   33 (40)
T ss_pred             chHHHHHHHHHHhh
Confidence            44444555544544


No 55 
>PF13623 SurA_N_2:  SurA N-terminal domain
Probab=22.95  E-value=80  Score=22.06  Aligned_cols=26  Identities=12%  Similarity=0.216  Sum_probs=17.8

Q ss_pred             CCCcccchHHHHHHHHHHHHHHhccc
Q 048295            2 GNSCRRVPLMILLLWFIFIFITISHC   27 (80)
Q Consensus         2 g~~~~r~~~~~~lllllL~l~~~~~C   27 (80)
                      ++.+.|-.+.++++-+.|+.|+++-+
T Consensus         2 ~kIR~r~~lLi~vIglAL~aFIv~d~   27 (145)
T PF13623_consen    2 QKIRQRGGLLIIVIGLALFAFIVGDF   27 (145)
T ss_pred             hhHhhcchHHHHHHHHHHHHHHHHHH
Confidence            55666767777777777777777543


No 56 
>PRK00720 tatA twin arginine translocase protein A; Provisional
Probab=22.81  E-value=1e+02  Score=20.21  Aligned_cols=11  Identities=0%  Similarity=0.241  Sum_probs=4.8

Q ss_pred             HHHHHHHhccc
Q 048295           17 FIFIFITISHC   27 (80)
Q Consensus        17 llL~l~~~~~C   27 (80)
                      ++++++++|.-
T Consensus        13 lvIvlllFG~k   23 (78)
T PRK00720         13 LAVVLLLFGRG   23 (78)
T ss_pred             HHHHHHHhCcc
Confidence            33444445643


No 57 
>PRK01833 tatA twin arginine translocase protein A; Provisional
Probab=21.49  E-value=1.3e+02  Score=19.47  Aligned_cols=15  Identities=20%  Similarity=0.295  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHhccc
Q 048295           13 LLLWFIFIFITISHC   27 (80)
Q Consensus        13 ~lllllL~l~~~~~C   27 (80)
                      ++++++++++++|.-
T Consensus         9 lliIl~i~lllFG~k   23 (74)
T PRK01833          9 LLIIVAIIVLLFGTK   23 (74)
T ss_pred             HHHHHHHHHHHhCcc
Confidence            344444455556654


No 58 
>PRK03625 tatE twin arginine translocase protein E; Validated
Probab=20.74  E-value=1.3e+02  Score=19.05  Aligned_cols=15  Identities=13%  Similarity=0.204  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHHhccc
Q 048295           13 LLLWFIFIFITISHC   27 (80)
Q Consensus        13 ~lllllL~l~~~~~C   27 (80)
                      +++.++++++++|.-
T Consensus         9 lliIlvI~lllFGpk   23 (67)
T PRK03625          9 LLVVAALVVLLFGTK   23 (67)
T ss_pred             HHHHHHHHHHHcCcc
Confidence            444444555556654


No 59 
>PF04507 DUF576:  Protein of unknown function, DUF576;  InterPro: IPR007595 This family contains several uncharacterised staphylococcal proteins. Members of this family are mostly predicted lipoproteins, found in Staphylococcus aureus but are also found clustered in Staphylococcus epidermidis.; PDB: 4EG9_A 4EGD_B.
Probab=20.10  E-value=35  Score=26.97  Aligned_cols=18  Identities=22%  Similarity=0.440  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHhccccc
Q 048295           12 ILLLWFIFIFITISHCHG   29 (80)
Q Consensus        12 ~~lllllL~l~~~~~C~g   29 (80)
                      .+++.++++++++++|..
T Consensus         8 ~L~Is~liLii~I~GCg~   25 (257)
T PF04507_consen    8 ALYISLLILIIFIGGCGM   25 (257)
T ss_dssp             ------------------
T ss_pred             hHHHHHHhHheeeeeccC
Confidence            444555556666788964


Done!