Query         048310
Match_columns 102
No_of_seqs    77 out of 101
Neff          5.2 
Searched_HMMs 46136
Date          Fri Mar 29 08:22:26 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048310.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048310hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09733 VEFS-Box:  VEFS-Box of 100.0 2.8E-52 6.1E-57  299.9   7.2  100    3-102    14-113 (140)
  2 KOG2350 Zn-finger protein join 100.0   5E-47 1.1E-51  285.9   6.4   97    4-102    93-189 (221)
  3 PF08616 SPA:  Stabilization of  67.8     3.7   8E-05   28.2   1.7   35   58-92     13-49  (113)
  4 KOG3341 RNA polymerase II tran  63.4     3.9 8.4E-05   32.3   1.2   23   79-101    41-63  (249)
  5 PRK13710 plasmid maintenance p  42.9      20 0.00043   23.2   1.8   21   58-78     49-69  (72)
  6 PF03489 SapB_2:  Saposin-like   38.1      36 0.00077   18.1   2.1   16   81-96      2-17  (35)
  7 PF08246 Inhibitor_I29:  Cathep  36.8      17 0.00038   21.3   0.8   12   46-57     46-57  (58)
  8 PF07455 Psu:  Phage polarity s  30.3      32  0.0007   26.3   1.5   32   65-96     68-99  (188)
  9 TIGR02909 spore_YkwD uncharact  30.0 1.7E+02  0.0038   19.5   5.4   47   53-100     1-47  (127)
 10 PF13902 R3H-assoc:  R3H-associ  27.7      45 0.00098   23.0   1.8   12   58-69     69-80  (131)
 11 PF07879 PHB_acc_N:  PHB/PHA ac  27.1      23  0.0005   22.7   0.2   20    4-23      5-24  (64)
 12 PF04667 Endosulfine:  cAMP-reg  26.3      23 0.00049   23.6   0.1   12    3-14     30-41  (86)
 13 PF08916 Phe_ZIP:  Phenylalanin  25.3      37 0.00081   21.3   0.9   27   64-90      3-29  (59)
 14 COG5109 Uncharacterized conser  24.3      57  0.0012   27.3   2.0   22   48-69     56-77  (396)
 15 PF14998 Ripply:  Transcription  21.9      43 0.00093   22.6   0.7   10   26-35     78-87  (87)
 16 KOG4616 Mitochondrial ribosoma  21.3      51  0.0011   23.6   1.1   20   47-66    110-129 (137)
 17 TIGR01848 PHA_reg_PhaR polyhyd  21.2      36 0.00077   23.8   0.3   20    4-23      5-24  (107)
 18 PF07362 CcdA:  Post-segregatio  21.1      11 0.00025   24.1  -2.1   20   59-78     50-69  (72)
 19 PF14881 Tubulin_3:  Tubulin do  21.1      42 0.00092   24.8   0.6   15    7-21     16-30  (180)
 20 smart00848 Inhibitor_I29 Cathe  20.5      31 0.00068   19.7  -0.1   12   46-57     46-57  (57)

No 1  
>PF09733 VEFS-Box:  VEFS-Box of polycomb protein;  InterPro: IPR019135  The VEFS-Box is found in the the C-terminal region of the VRN2, EMF2, FIS2, and Su(z)12 polycomb proteins. This domain is characterised by an acidic cluster and a tryptophan/methionine-rich sequence, the acidic-W/M domain []. In some proteins the VEFS-Box is associated with a zinc-finger domain located roughly 100 residues towards the N terminus. These proteins are part of the polycomb cluster of proteins which control HOX gene transcription as it functions in heterochromatin-mediated repression []. 
Probab=100.00  E-value=2.8e-52  Score=299.90  Aligned_cols=100  Identities=61%  Similarity=1.007  Sum_probs=97.9

Q ss_pred             ccccCcccccccCccccccccccCCCCCCCccChHHHHHHHHHHhhccCCCChHHHHHHHHhHHHHHhhccccCCchHHH
Q 048310            3 SLVSQRQFFHSHRAQPMAWEQVVSDRDSEDEVDDDVADLEDRRMLDDFVDVTKDEKQMMHMWNSFVRKQRVLADGHIPWA   82 (102)
Q Consensus         3 ~~l~~R~ffhs~t~~pl~~~e~~~d~DSedE~D~~Wl~~k~r~~l~dF~Dv~~~EKefM~lWN~fv~r~r~~aD~~ip~a   82 (102)
                      .+||||+||||+||+||+|+|++||+|||||+|++||+++++++|+||+|||++||+||++||+||+|||++||+|||+|
T Consensus        14 ~~~~~R~y~Hs~t~~p~~~~e~~sd~DSedE~D~~wl~~~~r~~l~dF~Dv~~~EKefM~lWN~fv~k~r~~aD~~ip~a   93 (140)
T PF09733_consen   14 ILLHNRQYFHSRTCQPMRPEEVLSDRDSEDEVDDEWLDQKHRRMLDDFSDVNEEEKEFMKLWNSFVMKQRVIADGHIPWA   93 (140)
T ss_pred             hhccCcceeccccceeccHHHhcCCCCCCCcCCHHHHHHHHHHHHHHccCCCHHHHHHHHHHHHHHHHccCcchHHHHHH
Confidence            46999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhhhcCCCCCC
Q 048310           83 CEAFTKLYGHDLVQAPALKW  102 (102)
Q Consensus        83 c~~Fv~~~~~~L~~~~~l~~  102 (102)
                      |++||+.||+||+++|+|+|
T Consensus        94 c~~Fv~~~~~~L~~~~~l~~  113 (140)
T PF09733_consen   94 CEAFVREHGQWLVEKPNLRR  113 (140)
T ss_pred             HHHHHHHhHHHHhhChhHHH
Confidence            99999999999999999874


No 2  
>KOG2350 consensus Zn-finger protein joined to JAZF1 (predicted suppressor) [General function prediction only]
Probab=100.00  E-value=5e-47  Score=285.90  Aligned_cols=97  Identities=59%  Similarity=1.050  Sum_probs=94.3

Q ss_pred             cccCcccccccCccccccccccCCCCCCCccChHHHHHHHHHHhhccCCCChHHHHHHHHhHHHHHhhccccCCchHHHH
Q 048310            4 LVSQRQFFHSHRAQPMAWEQVVSDRDSEDEVDDDVADLEDRRMLDDFVDVTKDEKQMMHMWNSFVRKQRVLADGHIPWAC   83 (102)
Q Consensus         4 ~l~~R~ffhs~t~~pl~~~e~~~d~DSedE~D~~Wl~~k~r~~l~dF~Dv~~~EKefM~lWN~fv~r~r~~aD~~ip~ac   83 (102)
                      .|||||||||+|||||++++|++|+|||+|+ ++|++.++++||++|+|||++||+||++||+||+|||+|||+||||||
T Consensus        93 ~lhkRqffHS~t~qPl~leqvmsdrdsE~d~-dd~a~~e~~~mLe~fvdvne~ekr~mkLWNsfVrkqrviAD~hipwAC  171 (221)
T KOG2350|consen   93 RLHKRQFFHSDTCQPLRLEQVMSDRDSEKDE-DDWARLETSTMLEEFVDVNEGEKRVMKLWNSFVRKQRVIADGHIPWAC  171 (221)
T ss_pred             ccccceeeeccccCCCCHHHHhccccccccc-hhhhhhHHHHHHHHhccccHHHHHHHHHHHHHHHHhheeccCCCcHHH
Confidence            4999999999999999999999999999998 799999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhhcCCCCCC
Q 048310           84 EAFTKLYGHDLVQAPALKW  102 (102)
Q Consensus        84 ~~Fv~~~~~~L~~~~~l~~  102 (102)
                      ++|++.||++|+.++ |.|
T Consensus       172 eaFsrlhgq~m~~~~-l~~  189 (221)
T KOG2350|consen  172 EAFSRLHGQKMIKKN-LCW  189 (221)
T ss_pred             HHHHHHhHHHHHhch-hhH
Confidence            999999999999998 866


No 3  
>PF08616 SPA:  Stabilization of polarity axis
Probab=67.78  E-value=3.7  Score=28.24  Aligned_cols=35  Identities=14%  Similarity=0.363  Sum_probs=29.4

Q ss_pred             HHHHHHhHHHHHhhccccCCchHHH--HHHHHHHHHh
Q 048310           58 KQMMHMWNSFVRKQRVLADGHIPWA--CEAFTKLYGH   92 (102)
Q Consensus        58 KefM~lWN~fv~r~r~~aD~~ip~a--c~~Fv~~~~~   92 (102)
                      -+.|.+||+.+.+.|++-=++=|.+  |..||..-..
T Consensus        13 ~~i~~L~~alL~~krivv~s~~~~~~~~s~~Vlal~~   49 (113)
T PF08616_consen   13 PEIILLWEALLLGKRIVVYSPSPSAGEVSEFVLALCS   49 (113)
T ss_pred             hHHHHHHHHHHhCCCEEEECCCCCHHHHHHHHHHHHH
Confidence            4689999999999999988888888  9988875433


No 4  
>KOG3341 consensus RNA polymerase II transcription factor complex subunit [Transcription]
Probab=63.42  E-value=3.9  Score=32.26  Aligned_cols=23  Identities=13%  Similarity=0.222  Sum_probs=20.7

Q ss_pred             hHHHHHHHHHHHHhhhhcCCCCC
Q 048310           79 IPWACEAFTKLYGHDLVQAPALK  101 (102)
Q Consensus        79 ip~ac~~Fv~~~~~~L~~~~~l~  101 (102)
                      +..+.+.|++.|.++|.+||.+|
T Consensus        41 f~~~LeeFA~kH~~ei~knsqFR   63 (249)
T KOG3341|consen   41 FQEALEEFARKHKTEIRKNSQFR   63 (249)
T ss_pred             HHHHHHHHHHHHHHHHhhCHHHH
Confidence            56788999999999999999876


No 5  
>PRK13710 plasmid maintenance protein CcdA; Provisional
Probab=42.92  E-value=20  Score=23.16  Aligned_cols=21  Identities=19%  Similarity=0.265  Sum_probs=18.2

Q ss_pred             HHHHHHhHHHHHhhccccCCc
Q 048310           58 KQMMHMWNSFVRKQRVLADGH   78 (102)
Q Consensus        58 KefM~lWN~fv~r~r~~aD~~   78 (102)
                      ++.|..+|.||-++|+.+|.+
T Consensus        49 ~eai~~~n~~ve~~G~~~de~   69 (72)
T PRK13710         49 REGMAEVARFIEMNGSFADEN   69 (72)
T ss_pred             HHHHHHHHHHHHHhCCcHHhc
Confidence            678889999999999988865


No 6  
>PF03489 SapB_2:  Saposin-like type B, region 2;  InterPro: IPR008138 Saposins are small lysosomal proteins that serve as activators of various lysosomal lipid-degrading enzymes []. They probably act by isolating the lipid substrate from the membrane surroundings, thus making it more accessible to the soluble degradative enzymes. All mammalian saposins are synthesized as a single precursor molecule (prosaposin) which contains four Saposin-B domains, yielding the active saposins after proteolytic cleavage, and two Saposin-A domains that are removed in the activation reaction. The Saposin-B domains also occur in other proteins, many of them active in the lysis of membranes [, ].; PDB: 3BQQ_A 2RB3_B 2R0R_A 3BQP_A 2R1Q_A 1NKL_A 1L9L_A 1QDM_C 3RFI_A 4DDJ_A ....
Probab=38.06  E-value=36  Score=18.06  Aligned_cols=16  Identities=31%  Similarity=0.748  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHhhhhc
Q 048310           81 WACEAFTKLYGHDLVQ   96 (102)
Q Consensus        81 ~ac~~Fv~~~~~~L~~   96 (102)
                      ..|..||..|+..|+.
T Consensus         2 ~~C~~~V~~y~~~ii~   17 (35)
T PF03489_consen    2 DECKNFVDQYGPQIIQ   17 (35)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHH
Confidence            4699999999988764


No 7  
>PF08246 Inhibitor_I29:  Cathepsin propeptide inhibitor domain (I29);  InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  This entry represents a peptidase inhibitor domain, which belongs to MEROPS peptidase inhibitor family I29. The domain is also found at the N terminus of a variety of peptidase precursors that belong to MEROPS peptidase subfamily C1A; these include cathepsin L, papain, and procaricain (P10056 from SWISSPROT) []. It forms an alpha-helical domain that runs through the substrate-binding site, preventing access. Removal of this region by proteolytic cleavage results in activation of the enzyme. This domain is also found, in one or more copies, in a variety of cysteine peptidase inhibitors such as salarin [].; PDB: 3QT4_A 3QJ3_A 2C0Y_A 2L95_A 1CJL_A 1CS8_A 7PCK_A 1BY8_A 1PCI_A 2O6X_A ....
Probab=36.84  E-value=17  Score=21.33  Aligned_cols=12  Identities=42%  Similarity=0.670  Sum_probs=9.9

Q ss_pred             HhhccCCCChHH
Q 048310           46 MLDDFVDVTKDE   57 (102)
Q Consensus        46 ~l~dF~Dv~~~E   57 (102)
                      -|+.|+|++++|
T Consensus        46 ~~N~fsD~t~eE   57 (58)
T PF08246_consen   46 GLNQFSDMTPEE   57 (58)
T ss_dssp             -SSTTTTSSHHH
T ss_pred             eCccccCcChhh
Confidence            478999999987


No 8  
>PF07455 Psu:  Phage polarity suppression protein (Psu);  InterPro: IPR010006 This entry is represented by Bacteriophage P4, Psu, the polarity suppression protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family contains a number of phage polarity suppression proteins (Psu) (approximately 190 residues long). The Psu protein of Bacteriophage P4 causes suppression of transcriptional polarity in Escherichia coli by overcoming Rho termination factor activity [].
Probab=30.31  E-value=32  Score=26.27  Aligned_cols=32  Identities=13%  Similarity=0.237  Sum_probs=27.1

Q ss_pred             HHHHHhhccccCCchHHHHHHHHHHHHhhhhc
Q 048310           65 NSFVRKQRVLADGHIPWACEAFTKLYGHDLVQ   96 (102)
Q Consensus        65 N~fv~r~r~~aD~~ip~ac~~Fv~~~~~~L~~   96 (102)
                      +.+|..|..+-...+-+.+..|.+.||..|.+
T Consensus        68 g~yI~aH~~v~~i~~~~~l~dFMq~hG~aL~~   99 (188)
T PF07455_consen   68 GRYIRAHEEVQEISARQRLNDFMQQHGAALIA   99 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHH
Confidence            45677777777888999999999999999875


No 9  
>TIGR02909 spore_YkwD uncharacterized protein, YkwD family. Members of this protein family represent a subset of those belonging to Pfam family pfam00188 (SCP-like extracellular protein). Based on currently cuttoffs for this model, all member proteins are found in Bacteria capable of endospore formation. Members include a named but uncharacterized protein, YkwD of Bacillus subtilis. Only the C-terminal region is well-conserved and is included in the seed alignment for this model. Three members of this family have an N-terminal domain homologous to the spore coat assembly protein SafA.
Probab=29.99  E-value=1.7e+02  Score=19.53  Aligned_cols=47  Identities=15%  Similarity=0.140  Sum_probs=33.4

Q ss_pred             CChHHHHHHHHhHHHHHhhccccCCchHHHHHHHHHHHHhhhhcCCCC
Q 048310           53 VTKDEKQMMHMWNSFVRKQRVLADGHIPWACEAFTKLYGHDLVQAPAL  100 (102)
Q Consensus        53 v~~~EKefM~lWN~fv~r~r~~aD~~ip~ac~~Fv~~~~~~L~~~~~l  100 (102)
                      ++..|++++.+-|.+-.++++-+= .....+..-++.|+..++.+..+
T Consensus         1 ~~~~e~~~l~~iN~~R~~~Gl~pL-~~~~~L~~~A~~hA~~ma~~~~~   47 (127)
T TIGR02909         1 LTAEEKRVVELVNAERAKNGLKPL-KADPELSKVARLKSEDMRDKNYF   47 (127)
T ss_pred             CCHHHHHHHHHHHHHHHHcCCCCC-ccCHHHHHHHHHHHHHHHhCCcc
Confidence            467899999999999888765332 23344567777888888876544


No 10 
>PF13902 R3H-assoc:  R3H-associated N-terminal domain
Probab=27.73  E-value=45  Score=23.05  Aligned_cols=12  Identities=25%  Similarity=0.664  Sum_probs=7.7

Q ss_pred             HHHHHHhHHHHH
Q 048310           58 KQMMHMWNSFVR   69 (102)
Q Consensus        58 KefM~lWN~fv~   69 (102)
                      .++|..||.|+-
T Consensus        69 ~~~~~~Wd~f~~   80 (131)
T PF13902_consen   69 YQNAQLWDDFRN   80 (131)
T ss_pred             HHHHHHHHHHhh
Confidence            566777777753


No 11 
>PF07879 PHB_acc_N:  PHB/PHA accumulation regulator DNA-binding domain;  InterPro: IPR012909 This domain is found at the N terminus of the polyhydroxyalkanoate (PHA) synthesis regulators. These regulators have been shown to directly bind DNA and PHA []. The invariant nature of this domain compared to the C-terminal IPR007897 from INTERPRO domain(s) suggests that it contains the DNA-binding function. 
Probab=27.07  E-value=23  Score=22.69  Aligned_cols=20  Identities=10%  Similarity=0.308  Sum_probs=17.4

Q ss_pred             cccCcccccccCcccccccc
Q 048310            4 LVSQRQFFHSHRAQPMAWEQ   23 (102)
Q Consensus         4 ~l~~R~ffhs~t~~pl~~~e   23 (102)
                      -|+||..|++.+..=++.++
T Consensus         5 KY~NRRLYDT~~s~YiTL~d   24 (64)
T PF07879_consen    5 KYPNRRLYDTETSSYITLED   24 (64)
T ss_pred             ccCCCccccCCCceeEeHHH
Confidence            47999999999999888764


No 12 
>PF04667 Endosulfine:  cAMP-regulated phosphoprotein/endosulfine conserved region;  InterPro: IPR006760 This endosulphine family includes cAMP-regulated phosphoprotein 19 (ARPP-19), alpha endosulphine and protein Igo1.  No function has yet been assigned to ARPP-19 []. Endosulphine is the endogenous ligand for the ATP-dependent potassium channels which occupy a key position in the control of insulin release from the pancreatic beta cell by coupling cell polarity to metabolism []. Igo1 is required for initiation of G0 program. In the absence of stimulatory signals, cells may enter into a reversible quiescence (or G0) state that is typically characterised by low metabolic activity, including low rates of protein synthesis and transcription. Igo proteins associate with the mRNA decapping activator Dhh1, sheltering newly expressed mRNAs from degradation via the 5'-3' mRNA decay pathway, and thereby enabling their proper translation during initiation of the G0 program []. 
Probab=26.31  E-value=23  Score=23.61  Aligned_cols=12  Identities=25%  Similarity=0.584  Sum_probs=9.1

Q ss_pred             ccccCccccccc
Q 048310            3 SLVSQRQFFHSH   14 (102)
Q Consensus         3 ~~l~~R~ffhs~   14 (102)
                      ..|++|.||+|-
T Consensus        30 kkl~~rKYFDSg   41 (86)
T PF04667_consen   30 KKLQKRKYFDSG   41 (86)
T ss_pred             hhhccccccchH
Confidence            456779999884


No 13 
>PF08916 Phe_ZIP:  Phenylalanine zipper;  InterPro: IPR015012 The phenylalanine zipper consists of aromatic side chains from ten phenylalanine residues that are stacked within a hydrophobic core. This zipper mediates dimerisation of various proteins, such as APS, SH2-B and Lnk []. ; GO: 0004871 signal transducer activity, 0035556 intracellular signal transduction; PDB: 1Q2H_B.
Probab=25.34  E-value=37  Score=21.29  Aligned_cols=27  Identities=19%  Similarity=0.321  Sum_probs=18.2

Q ss_pred             hHHHHHhhccccCCchHHHHHHHHHHH
Q 048310           64 WNSFVRKQRVLADGHIPWACEAFTKLY   90 (102)
Q Consensus        64 WN~fv~r~r~~aD~~ip~ac~~Fv~~~   90 (102)
                      |..|--+|-..|-..+..+|..|+..|
T Consensus         3 W~EFCE~HA~aaA~dfAk~~~~f~~~n   29 (59)
T PF08916_consen    3 WREFCERHARAAARDFAKAFRRFINEN   29 (59)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            666666666666677777777777766


No 14 
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=24.30  E-value=57  Score=27.30  Aligned_cols=22  Identities=18%  Similarity=0.617  Sum_probs=20.3

Q ss_pred             hccCCCChHHHHHHHHhHHHHH
Q 048310           48 DDFVDVTKDEKQMMHMWNSFVR   69 (102)
Q Consensus        48 ~dF~Dv~~~EKefM~lWN~fv~   69 (102)
                      ++|.+++..|+.+-..||+++.
T Consensus        56 q~fd~Ls~~e~~~~~s~k~~~k   77 (396)
T COG5109          56 QEFDTLSHAEADLVGSWKSLLK   77 (396)
T ss_pred             CCcchhhHHHHHHHHHHHHHHH
Confidence            5788999999999999999985


No 15 
>PF14998 Ripply:  Transcription Regulator
Probab=21.86  E-value=43  Score=22.61  Aligned_cols=10  Identities=60%  Similarity=0.810  Sum_probs=6.9

Q ss_pred             CCCCCCCccC
Q 048310           26 SDRDSEDEVD   35 (102)
Q Consensus        26 ~d~DSedE~D   35 (102)
                      .|+|||||.+
T Consensus        78 ~DsdsedeeE   87 (87)
T PF14998_consen   78 EDSDSEDEEE   87 (87)
T ss_pred             cCCCcccccC
Confidence            5677777754


No 16 
>KOG4616 consensus Mitochondrial ribosomal protein L55 [Translation, ribosomal structure and biogenesis]
Probab=21.25  E-value=51  Score=23.58  Aligned_cols=20  Identities=20%  Similarity=0.280  Sum_probs=15.2

Q ss_pred             hhccCCCChHHHHHHHHhHH
Q 048310           47 LDDFVDVTKDEKQMMHMWNS   66 (102)
Q Consensus        47 l~dF~Dv~~~EKefM~lWN~   66 (102)
                      +-|-.|=|-+||+||+-|.+
T Consensus       110 ~~e~idd~fd~~eymkf~~a  129 (137)
T KOG4616|consen  110 IMEEIDDNFDAKEYMKFIKA  129 (137)
T ss_pred             ehhhhhcccCHHHHHHHHhc
Confidence            33556668899999999863


No 17 
>TIGR01848 PHA_reg_PhaR polyhydroxyalkanoate synthesis repressor PhaR. Poly-B-hydroxyalkanoates are lipidlike carbon/energy storage polymers found in granular inclusions. PhaR is a regulatory protein found in general near other proteins associated with polyhydroxyalkanoate (PHA) granule biosynthesis and utilization. It is found to be a DNA-binding homotetramer that is also capable of binding short chain hydroxyalkanoic acids and PHA granules. PhaR may regulate the expression of itself, of the phasins that coat granules, and of enzymes that direct carbon flux into polymers stored in granules.
Probab=21.20  E-value=36  Score=23.83  Aligned_cols=20  Identities=10%  Similarity=0.293  Sum_probs=17.5

Q ss_pred             cccCcccccccCcccccccc
Q 048310            4 LVSQRQFFHSHRAQPMAWEQ   23 (102)
Q Consensus         4 ~l~~R~ffhs~t~~pl~~~e   23 (102)
                      -|+||..|++.|..=++.++
T Consensus         5 KY~NRRLYDT~tS~YITLed   24 (107)
T TIGR01848         5 KYPNRRLYDTETSSYVTLED   24 (107)
T ss_pred             ccCCCcccCCCccceeeHHH
Confidence            47999999999999988764


No 18 
>PF07362 CcdA:  Post-segregation antitoxin CcdA;  InterPro: IPR009956 This entry consists of several Enterobacterial post-segregation antitoxin CcdA proteins. The F plasmid-carried bacterial toxin, the CcdB protein, is known to act on DNA gyrase in two different ways. CcdB poisons the gyrase-DNA complex, blocking the passage of polymerases and leading to double-strand breakage of the DNA. Alternatively, in cells that overexpress CcdB, the A subunit of DNA gyrase (GyrA) has been found as an inactive complex with CcdB. Both poisoning and inactivation can be prevented and reversed in the presence of the F plasmid-encoded antidote, the CcdA protein [].; PDB: 3HPW_C 2H3C_A 2H3A_B 2ADN_B 2ADL_B.
Probab=21.08  E-value=11  Score=24.09  Aligned_cols=20  Identities=20%  Similarity=0.496  Sum_probs=16.9

Q ss_pred             HHHHHhHHHHHhhccccCCc
Q 048310           59 QMMHMWNSFVRKQRVLADGH   78 (102)
Q Consensus        59 efM~lWN~fv~r~r~~aD~~   78 (102)
                      +-|..||.||-++|+.+|.+
T Consensus        50 ~ai~~~N~~ve~~G~~~de~   69 (72)
T PF07362_consen   50 EAIEAYNRFVEEHGLFSDEY   69 (72)
T ss_dssp             CSCCSSSHSSSCSSSCSSSC
T ss_pred             HHHHHHHHHHHHcCCcHHHc
Confidence            45678899999999999876


No 19 
>PF14881 Tubulin_3:  Tubulin domain
Probab=21.06  E-value=42  Score=24.75  Aligned_cols=15  Identities=13%  Similarity=0.275  Sum_probs=13.3

Q ss_pred             CcccccccCcccccc
Q 048310            7 QRQFFHSHRAQPMAW   21 (102)
Q Consensus         7 ~R~ffhs~t~~pl~~   21 (102)
                      +|.+||++|.++|..
T Consensus        16 ~r~~yhPrSl~~l~~   30 (180)
T PF14881_consen   16 NRVHYHPRSLNQLND   30 (180)
T ss_pred             CcceeCCCceEEcCc
Confidence            689999999998874


No 20 
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29). This domain is found at the N-terminus of some C1 peptidases such as Cathepsin L where it acts as a propeptide. There are also a number of proteins that are composed solely of multiple copies of this domain such as the peptidase inhibitor salarin. This family is classified as I29 by MEROPS. Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a s
Probab=20.52  E-value=31  Score=19.69  Aligned_cols=12  Identities=42%  Similarity=0.744  Sum_probs=8.9

Q ss_pred             HhhccCCCChHH
Q 048310           46 MLDDFVDVTKDE   57 (102)
Q Consensus        46 ~l~dF~Dv~~~E   57 (102)
                      .|+.|+|++++|
T Consensus        46 ~~N~fsDlt~eE   57 (57)
T smart00848       46 GLNQFADLTNEE   57 (57)
T ss_pred             cCcccccCCCCC
Confidence            367888888765


Done!