BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048323
         (99 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q924C9|S26A3_RAT Chloride anion exchanger OS=Rattus norvegicus GN=Slc26a3 PE=2 SV=1
          Length = 757

 Score = 29.6 bits (65), Expect = 5.0,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 1   MQGSWIVRQSDGS--TPCLLGKAVDCNYIRGPKLMLACSSTVANGVLGLVIGVI 52
           M G  + R + GS  +P L   + + + +   K+M+A S TV +G++ L++GV+
Sbjct: 136 MVGVVVTRVASGSDTSPALSSSSAENDSMIEEKVMVAASVTVLSGIIQLLLGVL 189


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.319    0.135    0.392 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,572,645
Number of Sequences: 539616
Number of extensions: 1173571
Number of successful extensions: 2601
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2599
Number of HSP's gapped (non-prelim): 3
length of query: 99
length of database: 191,569,459
effective HSP length: 68
effective length of query: 31
effective length of database: 154,875,571
effective search space: 4801142701
effective search space used: 4801142701
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)