BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048343
         (347 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4GF2|A Chain A, Crystal Structure Of Plasmodium Falciparum Erythrocyte
           Binding Antigen 140 (Pfeba-140BAEBL)
          Length = 615

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 55  LVSRFLTSTKTPRPYSILIFFDAHQLHNK-----PELHLQELRNEFSLVASSFIANNVD 108
           L SR  T  K    + I +  +A  L+NK     P +   ELRN FS   +SFI +++D
Sbjct: 49  LNSRLETMEKFKEIFLISVNTEAKLLYNKNEGKDPSIFCNELRNSFSDFRNSFIGDDMD 107


>pdb|1AVA|A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed
 pdb|1AVA|B Chain B, Amy2BASI PROTEIN-Protein Complex From Barley Seed
 pdb|1AMY|A Chain A, Crystal And Molecular Structure Of Barley Alpha-Amylase
 pdb|1BG9|A Chain A, Barley Alpha-Amylase With Substrate Analogue Acarbose
          Length = 403

 Score = 29.6 bits (65), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 6/71 (8%)

Query: 273 QLGAEGFAVGFLYTIVGLLLALMTHGLVRVKSVSIQRWVMIVSLLISFWAVNKVIYLDNW 332
           ++G +G A  F +T  G+L   +   L R++    +        +I +W    V ++DN 
Sbjct: 234 KVGGKGPATTFDFTTKGILNVAVEGELWRLRGTDGK-----APGMIGWWPAKAVTFVDNH 288

Query: 333 KTGYGVHGFWP 343
            TG   H  WP
Sbjct: 289 DTGSTQH-MWP 298


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.413 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,999,277
Number of Sequences: 62578
Number of extensions: 322742
Number of successful extensions: 603
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 603
Number of HSP's gapped (non-prelim): 2
length of query: 347
length of database: 14,973,337
effective HSP length: 100
effective length of query: 247
effective length of database: 8,715,537
effective search space: 2152737639
effective search space used: 2152737639
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 52 (24.6 bits)