Citrus Sinensis ID: 048396


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MGMEVAAEEEPKKKCRALIFTYGTLKRGFSNHNLIQDLMLTGDAVFRGAYTTSESFPLVCGPYRVPFLLNIPGSGHPVTGELYAVSAYGLSRMDELEGTSRGHYQRLGPIRVTKAAAAEEADDDSDDEAEAEAEAYFADRSYEMELWKKSGKLGFRWYGEKEAKGYVKRKDRPQNLSFLEHIRIFLSSSTDQ
cccEEEcccccccccccEEEEEccccccccccHHHHHccccccEEEEEEEECcccccEEEccccccEEECcccccccEEEEEEEEcHHHHHHHHccccccccccEEEEEEEEEccccccccccccccccEEEEEEEEccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHcccccc
**************CRALIFTYGTLKRGFSNHNLIQDLMLTGDAVFRGAYTTSESFPLVCGPYRVPFLLNIPGSGHPVTGELYAVSAYGLSRMDELEGTSRGHYQRLGPIRVTKAAAAEEADDDSDDEAEAEAEAYFADRSYEMELWKKSGKLGFRWYGEKEAKGYVKRKDRPQNLSFLEHIRIFLS*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMEVAAEEEPKKKCRALIFTYGTLKRGFSNHNLIQDLMLTGDAVFRGAYTTSESFPLVCGPYRVPFLLNIPGSGHPVTGELYAVSAYGLSRMDELEGTSRGHYQRLGPIRVTKAAAAEEADDDSDDEAEAEAEAYFADRSYEMELWKKSGKLGFRWYGEKEAKGYVKRKDRPQNLSFLEHIRIFLSSSTDQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative gamma-glutamylcyclotransferase At3g02910 Putative gamma-glutamylcyclotransferase.probableQ9M8T3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JUD, chain A
Confidence level:very confident
Coverage over the Query: 16-170
View the alignment between query and template
View the model in PyMOL
Template: 2G0Q, chain A
Confidence level:confident
Coverage over the Query: 14-174
View the alignment between query and template
View the model in PyMOL