BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 048420
(386 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3LXY|A Chain A, Crystal Structure Of 4-Hydroxythreonine-4-Phosphate
Dehydrogenase From Yersinia Pestis Co92
Length = 334
Score = 30.8 bits (68), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 16/73 (21%)
Query: 85 TCVNLVPGFMQTGPDHW---------DAAVQLELIQKHDAPARATKIKKMDHGIEF---- 131
T VN+VPG + G H+ D A+ E P + + I D GI F
Sbjct: 84 TAVNVVPGKLDVGNSHYVVETLAKACDGAISGEFAALVTGPVQKSIIN--DAGIPFIGHT 141
Query: 132 -FFSGRSHAVKFV 143
FF+ RSH + V
Sbjct: 142 EFFADRSHCQRVV 154
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.133 0.391
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,541,621
Number of Sequences: 62578
Number of extensions: 411270
Number of successful extensions: 963
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 961
Number of HSP's gapped (non-prelim): 10
length of query: 386
length of database: 14,973,337
effective HSP length: 101
effective length of query: 285
effective length of database: 8,652,959
effective search space: 2466093315
effective search space used: 2466093315
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)