BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048420
         (386 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LXY|A Chain A, Crystal Structure Of 4-Hydroxythreonine-4-Phosphate
           Dehydrogenase From Yersinia Pestis Co92
          Length = 334

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 16/73 (21%)

Query: 85  TCVNLVPGFMQTGPDHW---------DAAVQLELIQKHDAPARATKIKKMDHGIEF---- 131
           T VN+VPG +  G  H+         D A+  E       P + + I   D GI F    
Sbjct: 84  TAVNVVPGKLDVGNSHYVVETLAKACDGAISGEFAALVTGPVQKSIIN--DAGIPFIGHT 141

Query: 132 -FFSGRSHAVKFV 143
            FF+ RSH  + V
Sbjct: 142 EFFADRSHCQRVV 154


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.133    0.391 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,541,621
Number of Sequences: 62578
Number of extensions: 411270
Number of successful extensions: 963
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 961
Number of HSP's gapped (non-prelim): 10
length of query: 386
length of database: 14,973,337
effective HSP length: 101
effective length of query: 285
effective length of database: 8,652,959
effective search space: 2466093315
effective search space used: 2466093315
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)