Citrus Sinensis ID: 048439


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610---
MDDPYLTDARPSALPVNQSIHLTWIRNYSAPDLVYETARTMGQDREINEKYNLTWEFEVDSGFTYFLRLHFCEFQIEVTEDGDRVFQIFIANLTAEVQADVIAWTGANGVTVYRDYAVMIGSKPNEENIKQNLSIQLHPAPRWRTKYSDAILNGLEIFKVDNTGNLGGPNPEPRTIPPNLDASPTIEPTKKNNVTGMVAGAISGSSVLSLLLLLIFWRGRKVKDSSSGTGTSLLGTFLWSKTIKATKSSRGSFLPSDLCTQFSLSEIQAATNNFDNDLVIGVGGFGDVYKGFINGSTTPVAIKRLEPESQQGALEFQTEIGMLSQLRHLHLVSLIGFCNDDREMILVYDFMARGTLPDHLYHSDNPPLPWNQRLEICIGAARGLHYLHTGANHAVIIHRDVKTTNILLDEKWVAKVSDFGLSKFGPTSVSKTHLDPEYYRLQQLTEKSDVYSFGVVLFEVLCARPSILRTAAKKQVSLAVWAQQCYQNGTIDQIVDPFLKAMSCLNDEGIRRPSMSDVVWGLEFSLQLQESSIAIAKEIDENEEEEKLLDNYETDGSGPVFSSVGEHVLSDSKTISTVTISTTTATDDQSLSTGSSDKYTGAVFSEILNPKGR
cccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccEEEEEECcccccEEEEEEEEcccccccccccEEEEEEEccccccccccHHHHcccccCEEEEEEEEEcccccccccccccEEEEEECcccccccccccccccEEEEEECcccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHEEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEEccccEEEEEEEccccccccHHHHHHHHHHHHcccccccccEEEEEccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccccccHHccccccccccccHHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccc
***PYLTDARPSALPVNQSIHLTWIRNYSAPDLVYETARTMGQDREINEKYNLTWEFEVDSGFTYFLRLHFCEFQIEVTEDGDRVFQIFIANLTAEVQADVIAWTGANGVTVYRDYAVMIGSKPNEENIKQNLSIQLHPAPRWRTKYSDAILNGLEIFKVDNTGNLGGP*************************TGMVAGAISGSSVLSLLLLLIFWRGRK********************************L*SDLCTQFSLSEIQAATNNFDNDLVIGVGGFGDVYKGFINGSTTPVAIKRL******GALEFQTEIGMLSQLRHLHLVSLIGFCNDDREMILVYDFMARGTLPDHLYHSDNPPLPWNQRLEICIGAARGLHYLHTGANHAVIIHRDVKTTNILLDEKWVAKVSDFGLSKFGPTSVSKTHLDPEYYRLQQLTEKSDVYSFGVVLFEVLCARPSILRTAAKKQVSLAVWAQQCYQNGTIDQIVDPFLKAMSCLNDEGIRRPSMSDVVWGLEFSLQLQESSI*************************************************************************ILNP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDPYLTDARPSALPVNQSIHLTWIRNYSAPDLVYETARTMGQDREINEKYNLTWEFEVDSGFTYFLRLHFCEFQIEVTEDGDRVFQIFIANLTAEVQADVIAWTGANGVTVYRDYAVMIGSKPNEENIKQNLSIQLHPAPRWRTKYSDAILNGLEIFKVDNTGNLGGPNPEPRTIPPNLDASPTIEPTKKNNVTGMVAGAISGSSVLSLLLLLIFWRGRKVKDSSSGTGTSLLGTFLWSKTIKATKSSRGSFLPSDLCTQFSLSEIQAATNNFDNDLVIGVGGFGDVYKGFINGSTTPVAIKRLEPESQQGALEFQTEIGMLSQLRHLHLVSLIGFCNDDREMILVYDFMARGTLPDHLYHSDNPPLPWNQRLEICIGAARGLHYLHTGANHAVIIHRDVKTTNILLDEKWVAKVSDFGLSKFGPTSVSKTHLDPEYYRLQQLTEKSDVYSFGVVLFEVLCARPSILRTAAKKQVSLAVWAQQCYQNGTIDQIVDPFLKAMSCLNDEGIRRPSMSDVVWGLEFSLQLQESSIAxxxxxxxxxxxxxxxxxxxxxGSGPVFSSVGEHVLSDSKTISTVTISTTTATDDQSLSTGSSDKYTGAVFSEILNPKGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Receptor-like protein kinase FERONIA Receptor-like protein kinase that mediates the female control of male gamete delivery during fertilization, including growth cessation of compatible pollen tubes ensuring a reproductive isolation barriers. Required for cell elongation during vegetative growth, mostly in a brassinosteroids- (BR-) independent manner.probableQ9SCZ4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QKW, chain B
Confidence level:very confident
Coverage over the Query: 263-530
View the alignment between query and template
View the model in PyMOL
Template: 2JWP, chain A
Confidence level:confident
Coverage over the Query: 25-159
View the alignment between query and template
View the model in PyMOL
Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 194-221
View the alignment between query and template
View the model in PyMOL