Query         048472
Match_columns 163
No_of_seqs    211 out of 735
Neff          5.6 
Searched_HMMs 46136
Date          Fri Mar 29 09:50:19 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048472.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048472hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00768 X8 Possibly involve 100.0 1.2E-33 2.5E-38  202.3   8.9   85   76-161     1-85  (85)
  2 PF07983 X8:  X8 domain;  Inter  99.9 5.3E-26 1.2E-30  160.6   7.0   73   76-148     1-78  (78)
  3 PF13956 Ibs_toxin:  Toxin Ibs,  66.1     3.2   7E-05   21.7   0.8   16    1-16      1-16  (19)
  4 PF06842 DUF1242:  Protein of u  47.9     8.3 0.00018   23.5   0.6   24   18-41     10-35  (36)
  5 PF07172 GRP:  Glycine rich pro  38.9      25 0.00054   25.6   2.0   19    3-21      4-22  (95)
  6 PF09628 YvfG:  YvfG protein;    23.4      51  0.0011   22.5   1.3    9  125-133    27-35  (68)
  7 PF07804 HipA_C:  HipA-like C-t  19.7      45 0.00096   22.6   0.5   18   26-43     51-68  (79)
  8 TIGR02804 ExbD_2 TonB system t  19.5      74  0.0016   23.3   1.7   12    8-20     12-23  (121)
  9 PF05479 PsaN:  Photosystem I r  19.1      81  0.0018   24.6   1.9   33   29-65     80-114 (138)
 10 PRK11024 colicin uptake protei  19.1      75  0.0016   24.0   1.7   11    9-19     23-33  (141)

No 1  
>smart00768 X8 Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
Probab=100.00  E-value=1.2e-33  Score=202.31  Aligned_cols=85  Identities=39%  Similarity=0.849  Sum_probs=82.5

Q ss_pred             eeEEecCCCChHHHHHHHHHhhcCCCCCccccCCCCCCCCCCChhhhhhHHHHHHHHHhCCCCCCCCCCCceEEEecCCC
Q 048472           76 TWCIAKPSTGDERLNANIQFCCQQPDIDCSIIQPGGRSYNPNNYYSHASVVMHLYYKANYKLPHTCDFMQSGLIISQDPS  155 (163)
Q Consensus        76 ~wCV~~~~~~~~~l~~~l~yaC~~~~~dCt~I~~ggsC~~~~t~~~~aSyAfN~YYq~~~~~~~aCdF~G~A~it~~dpS  155 (163)
                      +|||+++++++++|+++|+|||+++ +||++|++||+||+|+++++|||||||+|||.+++..++|||+|.|+++++|||
T Consensus         1 ~wCv~~~~~~~~~l~~~~~yaCg~~-~dC~~I~~~g~c~~~~~~~~~aS~a~N~YYq~~~~~~~aC~F~G~a~~~~~~ps   79 (85)
T smart00768        1 LWCVAKPDADEAALQAALDYACGQG-ADCTAIQPGGSCYSPNTVKAHASYAFNSYYQKQGQSSGACDFGGTATITTTDPS   79 (85)
T ss_pred             CccccCCCCCHHHHHHHHHHHhcCC-CCccccCCCCcccCCCCHHHHHHHHHHHHHHHcCCCCCcCCCCCceEEEecCCC
Confidence            5999999999999999999999995 599999999999999999999999999999999999999999999999999999


Q ss_pred             CCceee
Q 048472          156 VGECIY  161 (163)
Q Consensus       156 ~~~C~f  161 (163)
                      .++|+|
T Consensus        80 ~~~C~~   85 (85)
T smart00768       80 TGSCKF   85 (85)
T ss_pred             CCccCC
Confidence            999987


No 2  
>PF07983 X8:  X8 domain;  InterPro: IPR012946 The X8 domain [] contains 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen [] as well as at the C terminus of family 17 glycosyl hydrolases []. This domain may be involved in carbohydrate binding.; PDB: 2JON_A 2W61_A 2W62_A 2W63_A.
Probab=99.93  E-value=5.3e-26  Score=160.56  Aligned_cols=73  Identities=33%  Similarity=0.705  Sum_probs=61.7

Q ss_pred             eeEEecCCCChHHHHHHHHHhhcCCCCCccccCCCCC-----CCCCCChhhhhhHHHHHHHHHhCCCCCCCCCCCceE
Q 048472           76 TWCIAKPSTGDERLNANIQFCCQQPDIDCSIIQPGGR-----SYNPNNYYSHASVVMHLYYKANYKLPHTCDFMQSGL  148 (163)
Q Consensus        76 ~wCV~~~~~~~~~l~~~l~yaC~~~~~dCt~I~~ggs-----C~~~~t~~~~aSyAfN~YYq~~~~~~~aCdF~G~A~  148 (163)
                      +|||++|++++++|+++|+|||++.++||++|++||+     .|++|+.++|||||||+|||.+++.+.+|||+|+||
T Consensus         1 l~Cv~~~~~~~~~l~~~l~~aC~~~~~dC~~I~~~g~~G~YG~~S~C~~~~~lSya~N~YY~~~~~~~~~C~F~G~at   78 (78)
T PF07983_consen    1 LWCVAKPDADDKELQDLLDYACGQGGVDCSPIQPNGTTGVYGAYSMCSPRQHLSYAFNQYYQKQGRNSSACDFSGNAT   78 (78)
T ss_dssp             -EEEE-TTS-HHHHHHHHHHHTTT-SSSCCCC-EETTTTEE-TTTTS-CCHHHHHHHHHHHHHHTSSCCG-SS-STEE
T ss_pred             CcceeCCCCCHHHHHHHHHHHHcCCCCChhhhCCCCcccccccccCCCHHHHHHHHHHHHHHHcCCCCCcCCCCCCCC
Confidence            6999999999999999999999996569999999999     477777899999999999999999999999999996


No 3  
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=66.10  E-value=3.2  Score=21.74  Aligned_cols=16  Identities=50%  Similarity=0.683  Sum_probs=10.5

Q ss_pred             CcchhhHHHHHHHHHH
Q 048472            1 MAKQLSAFVLLLLIIF   16 (163)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (163)
                      |-|..-..+.||||+|
T Consensus         1 MMk~vIIlvvLLliSf   16 (19)
T PF13956_consen    1 MMKLVIILVVLLLISF   16 (19)
T ss_pred             CceehHHHHHHHhccc
Confidence            4566666667777775


No 4  
>PF06842 DUF1242:  Protein of unknown function (DUF1242);  InterPro: IPR009653 This family consists of a number of eukaryotic proteins of around 72 residues in length. The function of this family is unknown.
Probab=47.90  E-value=8.3  Score=23.47  Aligned_cols=24  Identities=13%  Similarity=0.171  Sum_probs=17.8

Q ss_pred             hhcCcceeccCcccccccc--ccccc
Q 048472           18 LSSTMATVLSLKCFERSEI--TCNIF   41 (163)
Q Consensus        18 ~~~~~~~~~~~g~fersEr--hwGlF   41 (163)
                      =.-+=.+++.|+-++|+|+  -+|+|
T Consensus        10 CTCtYir~~~P~l~dr~kk~G~~G~f   35 (36)
T PF06842_consen   10 CTCTYIRSIFPSLLDRNKKTGFRGVF   35 (36)
T ss_pred             HHhHhHHhHCccccccCCCccccccc
Confidence            4667788999999998543  56766


No 5  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=38.89  E-value=25  Score=25.57  Aligned_cols=19  Identities=37%  Similarity=0.462  Sum_probs=8.9

Q ss_pred             chhhHHHHHHHHHHHhhcC
Q 048472            3 KQLSAFVLLLLIIFLLSST   21 (163)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~   21 (163)
                      |.|-++.+||.++++++.|
T Consensus         4 K~~llL~l~LA~lLlisSe   22 (95)
T PF07172_consen    4 KAFLLLGLLLAALLLISSE   22 (95)
T ss_pred             hHHHHHHHHHHHHHHHHhh
Confidence            4444444444444444443


No 6  
>PF09628 YvfG:  YvfG protein;  InterPro: IPR018590  Yvfg is a hypothetical protein of 71 residues expressed in some bacteria. The monomer consists of two parallel alpha helices, and the protein crystallises as a homo-dimer. ; PDB: 2GSV_A 2JS1_B.
Probab=23.40  E-value=51  Score=22.51  Aligned_cols=9  Identities=33%  Similarity=0.807  Sum_probs=7.6

Q ss_pred             HHHHHHHHH
Q 048472          125 VVMHLYYKA  133 (163)
Q Consensus       125 yAfN~YYq~  133 (163)
                      -|||+||..
T Consensus        27 ~AmNaYYr~   35 (68)
T PF09628_consen   27 HAMNAYYRS   35 (68)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            489999985


No 7  
>PF07804 HipA_C:  HipA-like C-terminal domain;  InterPro: IPR012893 The members of this entry are similar to a region close to the C terminus of the HipA protein expressed by various bacterial species (for example P23874 from SWISSPROT). This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis []. When expressed alone, it is toxic to bacterial cells [], but it is usually tightly associated with HipB [], and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products []. ; PDB: 3AKL_D 3AKJ_B 3AKK_D 2WIU_C 3HZI_A 3DNT_B 3FBR_A 3DNU_A 3DNV_A.
Probab=19.67  E-value=45  Score=22.58  Aligned_cols=18  Identities=6%  Similarity=0.026  Sum_probs=11.7

Q ss_pred             ccCccccccccccccccc
Q 048472           26 LSLKCFERSEITCNIFIS   43 (163)
Q Consensus        26 ~~~g~fersErhwGlF~D   43 (163)
                      +..||-.|+=+|||++.+
T Consensus        51 ~ligN~D~H~kN~s~l~~   68 (79)
T PF07804_consen   51 YLIGNTDRHLKNFSFLYD   68 (79)
T ss_dssp             HHCTBS---CCCSEEEEE
T ss_pred             HHHcCCcCCcCCEEEEEc
Confidence            457899998889999944


No 8  
>TIGR02804 ExbD_2 TonB system transport protein ExbD, group 2. Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Probab=19.49  E-value=74  Score=23.35  Aligned_cols=12  Identities=33%  Similarity=0.523  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHhhc
Q 048472            8 FVLLLLIIFLLSS   20 (163)
Q Consensus         8 ~~~~~~~~~~~~~   20 (163)
                      ++++|| +||++.
T Consensus        12 VvflLL-iFFmvt   23 (121)
T TIGR02804        12 IMLVLL-AIVLII   23 (121)
T ss_pred             HHHHHH-HHHHHH
Confidence            344444 444443


No 9  
>PF05479 PsaN:  Photosystem I reaction centre subunit N (PSAN or PSI-N);  InterPro: IPR008796 This family contains several Photosystem I reaction centre subunit N (PSI-N) proteins. The protein has no known function although it is localised in the thylakoid lumen []. PSI-N is a small extrinsic subunit at the lumen side and is very likely involved in the docking of plastocyanin.; GO: 0005516 calmodulin binding, 0015979 photosynthesis, 0009522 photosystem I, 0042651 thylakoid membrane; PDB: 2WSE_N 2WSC_N 2WSF_N 2O01_N.
Probab=19.14  E-value=81  Score=24.63  Aligned_cols=33  Identities=12%  Similarity=0.246  Sum_probs=21.3

Q ss_pred             cccccccccccccccCCccccccccc--cccccCCCCCC
Q 048472           29 KCFERSEITCNIFISLQPRYHQQMKA--NWEQATDTPNL   65 (163)
Q Consensus        29 g~fersErhwGlF~Dg~p~Y~i~l~g--~~~~a~~~~~l   65 (163)
                      -||+|   .+-+ ++|+-+||.++.|  .+...+.||++
T Consensus        80 aNfaR---~~tv-~fg~c~fP~n~~gc~~la~~~~v~f~  114 (138)
T PF05479_consen   80 ANFAR---AYTV-QFGTCKFPENFTGCQDLAKQKKVPFL  114 (138)
T ss_dssp             SSSTS---GTT---TSTSSSSS-SSSSSSS-STT-TTSS
T ss_pred             hhhhh---heee-ecccccCCccchhhHHHHHcCCCcee
Confidence            57888   3322 6899999999988  35556778887


No 10 
>PRK11024 colicin uptake protein TolR; Provisional
Probab=19.08  E-value=75  Score=24.01  Aligned_cols=11  Identities=36%  Similarity=0.899  Sum_probs=0.0

Q ss_pred             HHHHHHHHHhh
Q 048472            9 VLLLLIIFLLS   19 (163)
Q Consensus         9 ~~~~~~~~~~~   19 (163)
                      |.++||+||++
T Consensus        23 VvfvLLiFFmv   33 (141)
T PRK11024         23 VLLVLLLIFMA   33 (141)
T ss_pred             HHHHHHHHHHh


Done!