Query         048473
Match_columns 81
No_of_seqs    23 out of 25
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 09:50:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048473.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048473hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10784 Plasmid_stab_B:  Plasm  54.0     5.7 0.00012   25.8   0.6   32   37-68     17-59  (72)
  2 COG3449 DNA gyrase inhibitor [  48.3      12 0.00027   27.3   1.6   17    2-18     41-57  (154)
  3 cd03195 GST_C_4 GST_C family,   45.5      12 0.00027   23.5   1.1   32   41-72     57-88  (114)
  4 PRK13893 conjugal transfer pro  45.4      13 0.00028   28.5   1.5   35   41-76     69-104 (193)
  5 PF04695 Pex14_N:  Peroxisomal   44.9      19 0.00041   24.5   2.1   34   39-73      3-36  (136)
  6 PF07424 TrbM:  TrbM;  InterPro  42.8      15 0.00032   27.3   1.4   35   41-76     43-78  (165)
  7 PRK10177 putative invasin; Pro  41.8      12 0.00026   31.8   0.8   26    5-31    171-196 (465)
  8 PF12419 DUF3670:  SNF2 Helicas  40.7      14  0.0003   25.1   0.9   43   30-72     81-126 (141)
  9 cd08577 PI-PLCc_GDPD_SF_unchar  40.0      19  0.0004   26.6   1.5   59   11-72    140-199 (228)
 10 PF02071 NSF:  Aromatic-di-Alan  38.6     5.6 0.00012   18.3  -0.9    9   72-80      1-9   (12)
 11 COG3108 Uncharacterized protei  37.4      33 0.00071   26.1   2.5   37   34-70     62-98  (185)
 12 TIGR03114 cas_csf1 CRISPR-asso  33.2      22 0.00047   27.6   1.0   21   57-77    176-196 (202)
 13 PF02728 Cu_amine_oxidN3:  Copp  30.1      37 0.00079   21.6   1.5   29   46-74      1-32  (101)
 14 COG4154 FucU Fucose dissimilat  29.7      41 0.00089   24.9   1.9   21   53-73      2-23  (144)
 15 TIGR00758 UDG_fam4 uracil-DNA   29.5      24 0.00052   24.4   0.6   21   40-60     83-103 (173)
 16 cd06403 PB1_Par6 The PB1 domai  26.7      36 0.00078   22.9   1.1   18   33-50     57-74  (80)
 17 PRK14614 4-diphosphocytidyl-2-  25.8      40 0.00087   24.8   1.3   29   47-75    208-240 (280)
 18 PRK11190 Fe/S biogenesis prote  24.6      52  0.0011   24.1   1.7   18   35-52    108-126 (192)
 19 PF01106 NifU:  NifU-like domai  24.5      39 0.00086   20.7   0.9   14   39-52      2-15  (68)
 20 PRK13186 lpxC UDP-3-O-[3-hydro  23.6      35 0.00076   26.9   0.6   40    7-51    153-192 (295)
 21 PRK15318 intimin-like protein   23.4      32 0.00069   30.9   0.4   23    7-30    171-193 (730)
 22 PRK05362 phosphopentomutase; P  23.1      47   0.001   27.0   1.3   22   50-72    214-235 (394)
 23 PF10691 DUF2497:  Protein of u  22.8      37 0.00081   21.8   0.6   31   35-68     32-63  (73)
 24 COG3285 Predicted eukaryotic-t  22.6      27 0.00058   28.3  -0.2   48   18-66    220-274 (299)
 25 smart00759 Flu_M1_C Influenza   22.0      39 0.00084   23.6   0.6   20   55-74     47-66  (95)
 26 PF12010 DUF3502:  Domain of un  20.5      30 0.00064   23.3  -0.3   28   45-73     89-116 (134)
 27 TIGR00325 lpxC UDP-3-0-acyl N-  20.1   1E+02  0.0022   24.4   2.6   41    4-49    147-189 (297)

No 1  
>PF10784 Plasmid_stab_B:  Plasmid stability protein;  InterPro: IPR019720  This family is conserved in the Enterobacteriales. It is a putative plasmid stability protein in that it is expressed from the operon involved in stability, but its actual function has not yet been characterised but it may be involved in the control of plasmid partition.; PDB: 2JD3_A.
Probab=54.01  E-value=5.7  Score=25.84  Aligned_cols=32  Identities=28%  Similarity=0.361  Sum_probs=20.8

Q ss_pred             hHHHHHHhcccchhhh-----------hhhcCcCchHHHHHHH
Q 048473           37 YLETLVASARPFLRGE-----------LEAIDKNLPSLIVVLR   68 (81)
Q Consensus        37 ~l~~lla~aRPFLRgd-----------le~iDp~LPslisVLr   68 (81)
                      ...+.++..-+=.|||           +-++||+||.+|+.+-
T Consensus        17 ~a~~~iesv~~~~Rgdf~R~aliaG~aL~~~dprLP~lLa~~~   59 (72)
T PF10784_consen   17 RACATIESVPQRERGDFQRAALIAGLALHQLDPRLPYLLAALF   59 (72)
T ss_dssp             HHHHHHHTS-HHHHHHHHHHHHHHHHHHHHH-THHHHHHHHH-
T ss_pred             HHHHHHHccCHhHhhHHHHHHHHHHHHHHhcChHHHHHHHHHh
Confidence            3445566666666666           4578999999998874


No 2  
>COG3449 DNA gyrase inhibitor [DNA replication, recombination, and repair]
Probab=48.32  E-value=12  Score=27.29  Aligned_cols=17  Identities=35%  Similarity=0.536  Sum_probs=15.4

Q ss_pred             CCCCccceeeeeecccc
Q 048473            2 LSPSSSFSFNIFFDHPL   18 (81)
Q Consensus         2 ~~~~~~~~~~~~~~~~l   18 (81)
                      |+|.+|+-|||+.|+|=
T Consensus        41 l~p~~S~~~gI~~ddP~   57 (154)
T COG3449          41 LLPEQSETLGIYQDDPD   57 (154)
T ss_pred             CCCCCceEEEEecCCCC
Confidence            67889999999999986


No 3  
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.
Probab=45.46  E-value=12  Score=23.46  Aligned_cols=32  Identities=25%  Similarity=0.251  Sum_probs=24.1

Q ss_pred             HHHhcccchhhhhhhcCcCchHHHHHHHHcCC
Q 048473           41 LVASARPFLRGELEAIDKNLPSLIVVLRSVGA   72 (81)
Q Consensus        41 lla~aRPFLRgdle~iDp~LPslisVLrS~GA   72 (81)
                      +++..+|||-||+.-.|.-|-..+.-++..|-
T Consensus        57 ~l~~~~~~l~G~fSiAD~~l~~~~~~~~~~g~   88 (114)
T cd03195          57 LLPPGAANLFGEWCIADTDLALMLNRLVLNGD   88 (114)
T ss_pred             HHhcCCCcccCCccHHHHHHHHHHHHHHHcCC
Confidence            44445599999988889988877777766663


No 4  
>PRK13893 conjugal transfer protein TrbM; Provisional
Probab=45.41  E-value=13  Score=28.47  Aligned_cols=35  Identities=23%  Similarity=0.348  Sum_probs=27.1

Q ss_pred             HHHhcccchhh-hhhhcCcCchHHHHHHHHcCCcccc
Q 048473           41 LVASARPFLRG-ELEAIDKNLPSLIVVLRSVGAGEST   76 (81)
Q Consensus        41 lla~aRPFLRg-dle~iDp~LPslisVLrS~GAgECw   76 (81)
                      -+.+=|-||.. --..-||+.+.|+..+ +.|||+|-
T Consensus        69 T~~aR~~FLn~CP~a~~dp~~~~Lv~aI-~~gaG~Cd  104 (193)
T PRK13893         69 TIKARLNFLQLCPVANQTPEMQSLVSAI-SRGAGRCD  104 (193)
T ss_pred             HHHHHHHHHhcCCCCcCChhHHHHHHHH-hccCCCcC
Confidence            35566778877 3334699999999999 88999994


No 5  
>PF04695 Pex14_N:  Peroxisomal membrane anchor protein (Pex14p) conserved region;  InterPro: IPR006785 This conserved region defines a group of peroxisomal membrane anchor proteins which bind the PTS1 (peroxisomal targeting signal) receptor and are required for the import of PTS1-containing proteins into peroxisomes. Loss of functional Pex14p results in defects in both the PTS1 and PTS2-dependent import pathways. Deletion analysis of this conserved region implicates it in selective peroxisome degradation. In the majority of members this region is situated at the N terminus of the protein [, ].; GO: 0005777 peroxisome, 0016020 membrane; PDB: 2W85_A 2W84_A 3FF5_B.
Probab=44.87  E-value=19  Score=24.53  Aligned_cols=34  Identities=29%  Similarity=0.374  Sum_probs=25.2

Q ss_pred             HHHHHhcccchhhhhhhcCcCchHHHHHHHHcCCc
Q 048473           39 ETLVASARPFLRGELEAIDKNLPSLIVVLRSVGAG   73 (81)
Q Consensus        39 ~~lla~aRPFLRgdle~iDp~LPslisVLrS~GAg   73 (81)
                      +++|+.|+-||+++ .--|.-+-.-++-|++-|-.
T Consensus         3 e~li~~A~~FL~~p-~V~~sp~~~k~~FL~sKGLt   36 (136)
T PF04695_consen    3 EDLIEQAVKFLQDP-KVRNSPLEKKIAFLESKGLT   36 (136)
T ss_dssp             HHHHHHHHHHHCTT-TCCCS-HHHHHHHHHHCT--
T ss_pred             HHHHHHHHHHhCCc-ccccCCHHHHHHHHHcCCCC
Confidence            57899999999976 32366688889999988854


No 6  
>PF07424 TrbM:  TrbM;  InterPro: IPR009989 This family contains the bacterial protein TrbM (approximately 180 residues long). In Comamonas testosteroni T-2, TrbM is derived from the IncP1beta plasmid pTSA, which encodes the widespread genes for p-toluenesulphonate (TSA) degradation [].
Probab=42.76  E-value=15  Score=27.33  Aligned_cols=35  Identities=23%  Similarity=0.347  Sum_probs=25.2

Q ss_pred             HHHhcccchhhhhh-hcCcCchHHHHHHHHcCCcccc
Q 048473           41 LVASARPFLRGELE-AIDKNLPSLIVVLRSVGAGEST   76 (81)
Q Consensus        41 lla~aRPFLRgdle-~iDp~LPslisVLrS~GAgECw   76 (81)
                      -+.+=|-||..==. .=|+++|+++.. -+.|||+|-
T Consensus        43 T~~aR~~FL~~Cp~~~~~~~m~~Lv~a-i~ngagrCd   78 (165)
T PF07424_consen   43 TIDARKNFLNLCPTADSDPEMPKLVNA-IANGAGRCD   78 (165)
T ss_pred             HHHHHHHHHhcCCCCCCchhHHHHHHH-HhcCCCCcC
Confidence            35555678764321 228999999999 789999993


No 7  
>PRK10177 putative invasin; Provisional
Probab=41.76  E-value=12  Score=31.79  Aligned_cols=26  Identities=15%  Similarity=0.163  Sum_probs=20.3

Q ss_pred             CccceeeeeeccccccccCCCCCCCCC
Q 048473            5 SSSFSFNIFFDHPLIFNQNSTMPSQLG   31 (81)
Q Consensus         5 ~~~~~~~~~~~~~l~f~qns~m~s~~~   31 (81)
                      .--+..|.||||.+. .+|+|++-+.|
T Consensus       171 ~wmlG~N~F~D~dls-~~h~R~glGaE  196 (465)
T PRK10177        171 NWLLGYNTFYDNLLD-ENLQRAGFGAE  196 (465)
T ss_pred             CeEEEeEEEEccCCC-CCcceeeccce
Confidence            345778999999998 66789887743


No 8  
>PF12419 DUF3670:  SNF2 Helicase protein ;  InterPro: IPR022138  This domain family is found in bacteria, archaea and eukaryotes, and is approximately 140 amino acids in length. The family is found in association with PF00271 from PFAM, PF00176 from PFAM. Most of the proteins in this family are annotated as SNF2 helicases but there is little accompanying literature to confirm this. 
Probab=40.73  E-value=14  Score=25.11  Aligned_cols=43  Identities=23%  Similarity=0.420  Sum_probs=34.1

Q ss_pred             CCCCCCchHHHHHHhcccc--hhhhhhhcCc-CchHHHHHHHHcCC
Q 048473           30 LGNINNDYLETLVASARPF--LRGELEAIDK-NLPSLIVVLRSVGA   72 (81)
Q Consensus        30 ~~~~~~~~l~~lla~aRPF--LRgdle~iDp-~LPslisVLrS~GA   72 (81)
                      -+....+.+..+++..+|+  +||.|-.||| .+-...+.+...+.
T Consensus        81 d~~Ls~eEf~~L~~~~~~LV~~rg~WV~ld~~~l~~~~~~~~~~~~  126 (141)
T PF12419_consen   81 DEELSEEEFEQLVEQKRPLVRFRGRWVELDPEELRRALAFLEKAPK  126 (141)
T ss_pred             CEECCHHHHHHHHHcCCCeEEECCEEEEECHHHHHHHHHHHHhccc
Confidence            3566678899999999998  5799999999 66777777776554


No 9  
>cd08577 PI-PLCc_GDPD_SF_unchar3 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases. This subfamily corresponds to a group of uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipase C (PI-PLC), and glycerophosphodiester phosphodiesterases (GP-GDE), and also sphingomyelinases D (SMases D) and similar proteins. They hydrolyze the 3'-5' phosphodiester bonds in different substrates, utilizing a similar mechanism of general base and acid catalysis involving two conserved histidine residues.
Probab=40.00  E-value=19  Score=26.58  Aligned_cols=59  Identities=19%  Similarity=0.187  Sum_probs=31.9

Q ss_pred             eeeeccccccccCCCCCCCCCCCCCchHHHHHHhcccchhhhhhhc-CcCchHHHHHHHHcCC
Q 048473           11 NIFFDHPLIFNQNSTMPSQLGNINNDYLETLVASARPFLRGELEAI-DKNLPSLIVVLRSVGA   72 (81)
Q Consensus        11 ~~~~~~~l~f~qns~m~s~~~~~~~~~l~~lla~aRPFLRgdle~i-Dp~LPslisVLrS~GA   72 (81)
                      -||||-||....+...++...++.+..+......-   -+|.+..= =-.|++.+...++.|-
T Consensus       140 ~~f~D~~l~~~~~~~~~~~~~~~~S~~~~~~~~~~---~~g~~~~~q~~~l~~~v~~a~~~Gl  199 (228)
T cd08577         140 YIFFDGRLDEDLPDEQLARLSPMISASFAKFSKWN---GKGDTPEDEKEKLKSIIDKAHARGK  199 (228)
T ss_pred             eEEEeCChhhccccccccccceEEEccHHHhcCCC---CCCCCCHHHHHHHHHHHHHHHHCCC
Confidence            48999999865555555555556666666652211   12221110 0145666666666654


No 10 
>PF02071 NSF:  Aromatic-di-Alanine (AdAR) repeat ;  InterPro: IPR000744 Regulated exocytosis of neurotransmitters and hormones, as well as intracellular traffic, requires fusion of two lipid bilayers. SNARE proteins are thought to form a protein bridge, the SNARE complex, between an incoming vesicle and the acceptor compartment. SNARE proteins contribute to the specificity of membrane fusion, implying that the mechanisms by which SNAREs are targeted to subcellular compartments are important for specific docking and fusion of vesicles. This mechanism involves a family of conserved proteins, members of which appear to function at all sites of constitutive and regulated secretion in eukaryotes []. Among them are 2 types of cytosolic protein, NSF (N-ethyl-maleimide-sensitive protein) and the SNAPs (alpha-, beta- and gamma-soluble NSF attachment proteins). The yeast vesicular fusion protein, sec17, a cytoplasmic peripheral membrane protein involved in vesicular transport between the endoplasmic reticulum and the golgi apparatus, shows a high degree of sequence similarity to the alpha-SNAP family.  SNAP-25 and its non-neuronal homologue Syndet/SNAP-23 are synthesized as soluble proteins in the cytosol. Both SNAP-25 and Syndet/SNAP-23 are palmitoylated at cysteine residues clustered in a loop between two N- and C-terminal coils and palmitoylation is essential for membrane binding and plasma membrane targeting. The C-terminal and the N-terminal helices of SNAP-25, are each targeted to the plasma membrane by two distinct cysteine-rich domains and appear to regulate the availability of SNAP to form complexes with SNARE [].; GO: 0006886 intracellular protein transport
Probab=38.55  E-value=5.6  Score=18.32  Aligned_cols=9  Identities=33%  Similarity=0.054  Sum_probs=5.8

Q ss_pred             CcccccccC
Q 048473           72 AGESTEGAH   80 (81)
Q Consensus        72 AgECwHKhg   80 (81)
                      |+.||.|++
T Consensus         1 A~~~y~~Aa    9 (12)
T PF02071_consen    1 AIKCYEKAA    9 (12)
T ss_pred             CcHHHHHHH
Confidence            566777654


No 11 
>COG3108 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.36  E-value=33  Score=26.10  Aligned_cols=37  Identities=22%  Similarity=0.308  Sum_probs=29.9

Q ss_pred             CCchHHHHHHhcccchhhhhhhcCcCchHHHHHHHHc
Q 048473           34 NNDYLETLVASARPFLRGELEAIDKNLPSLIVVLRSV   70 (81)
Q Consensus        34 ~~~~l~~lla~aRPFLRgdle~iDp~LPslisVLrS~   70 (81)
                      .-..|..|=-.+|=|.++|--.+||.||.++..|..+
T Consensus        62 ~~a~L~~L~rl~rd~r~ne~~~mdp~l~dlv~~l~~~   98 (185)
T COG3108          62 DQASLSGLNRLLRDWRQNEVVRMDPRLFDLVYQLKTL   98 (185)
T ss_pred             CHHHHHHHHHhchHhhhCCceecCcchHHHHHHHHHH
Confidence            3455667777778899999999999999999988643


No 12 
>TIGR03114 cas_csf1 CRISPR-associated protein, Csf1 family. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf1 (CRISPR/cas Subtype as in A. ferrooxidans protein 1), as it lies closest to the repeats.
Probab=33.20  E-value=22  Score=27.58  Aligned_cols=21  Identities=24%  Similarity=0.346  Sum_probs=18.8

Q ss_pred             CcCchHHHHHHHHcCCccccc
Q 048473           57 DKNLPSLIVVLRSVGAGESTE   77 (81)
Q Consensus        57 Dp~LPslisVLrS~GAgECwH   77 (81)
                      +|.+|.-+.+|+|.+-||-|-
T Consensus       176 ~pa~~~A~~~Lqs~~vGE~W~  196 (202)
T TIGR03114       176 APAYPEAYQLLQSLTVGETWA  196 (202)
T ss_pred             ChhhHHHHHHHHhcCchHHHH
Confidence            678899999999999999883


No 13 
>PF02728 Cu_amine_oxidN3:  Copper amine oxidase, N3 domain;  InterPro: IPR015802 Amine oxidases (AO) are enzymes that catalyse the oxidation of a wide range of biogenic amines including many neurotransmitters, histamine and xenobiotic amines. There are two classes of amine oxidases: flavin-containing (1.4.3.4 from EC) and copper-containing (1.4.3.6 from EC). Copper-containing AO act as a disulphide-linked homodimer. They catalyse the oxidation of primary amines to aldehydes, with the subsequent release of ammonia and hydrogen peroxide, which requires one copper ion per subunit and topaquinone as cofactor []: RCH2NH2 + H2O + O2 = RCHO + NH3 + H2O2   Copper-containing amine oxidases are found in bacteria, fungi, plants and animals. In prokaryotes, the enzyme enables various amine substrates to be used as sources of carbon and nitrogen [, ]. In eukaryotes they have a broader range of functions, including cell differentiation and growth, wound healing, detoxification and cell signalling []. The copper amine oxidases occur as mushroom-shaped homodimers of 70-95 kDa, each monomer containing a copper ion and a covalently bound redox cofactor, topaquinone (TPQ). TPQ is formed by post-translational modification of a conserved tyrosine residue. The copper ion is coordinated with three histidine residues and two water molecules in a distorted square pyramidal geometry, and has a dual function in catalysis and TPQ biogenesis. The catalytic domain is the largest of the 3-4 domains found in copper amine oxidases, and consists of a beta sandwich of 18 strands in two sheets. The active site is buried and requires a conformational change to allow the substrate access. The two N-terminal domains share a common structural fold, its core consisting of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the stalk, of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other [, ].  This entry represents one (N3) of the two N-terminal domains (N2/N3) that share a similar structure.; GO: 0005507 copper ion binding, 0008131 primary amine oxidase activity, 0048038 quinone binding, 0009308 amine metabolic process, 0055114 oxidation-reduction process; PDB: 1TU5_A 2PNC_B 3MPH_B 3HII_B 3HI7_A 3K5T_A 3HIG_A 1SPU_A 2WGQ_A 2WO0_A ....
Probab=30.11  E-value=37  Score=21.63  Aligned_cols=29  Identities=17%  Similarity=0.324  Sum_probs=20.3

Q ss_pred             ccchhhhhhhcCc---CchHHHHHHHHcCCcc
Q 048473           46 RPFLRGELEAIDK---NLPSLIVVLRSVGAGE   74 (81)
Q Consensus        46 RPFLRgdle~iDp---~LPslisVLrS~GAgE   74 (81)
                      +|++.+|++.+..   +-|.+.+.|+.+|-..
T Consensus         1 ppi~~~E~~~~~~~~~~~p~~~~al~~rgi~d   32 (101)
T PF02728_consen    1 PPITLEEFAEAEEIVKADPEFQAALKKRGITD   32 (101)
T ss_dssp             S---HHHHHHHHHHHHTGHHHHHHHHHTTCSC
T ss_pred             CCcCHHHHHHHHHHHHHCHHHHHHHHHhCCCC
Confidence            5777788776644   7899999999999554


No 14 
>COG4154 FucU Fucose dissimilation pathway protein FucU [Carbohydrate transport and metabolism]
Probab=29.69  E-value=41  Score=24.91  Aligned_cols=21  Identities=43%  Similarity=0.741  Sum_probs=17.0

Q ss_pred             hhhcCcCc-hHHHHHHHHcCCc
Q 048473           53 LEAIDKNL-PSLIVVLRSVGAG   73 (81)
Q Consensus        53 le~iDp~L-PslisVLrS~GAg   73 (81)
                      |..|+|.| |.++..||+.|=|
T Consensus         2 LK~I~p~LspdlL~tLr~MGHG   23 (144)
T COG4154           2 LKGISPLLSPDLLKTLREMGHG   23 (144)
T ss_pred             CCCCCcccCHHHHHHHHHhCCC
Confidence            34578866 8999999999966


No 15 
>TIGR00758 UDG_fam4 uracil-DNA glycosylase, family 4. This well-conserved family of proteins is about 200 residues in length and homologous to the N-terminus of the DNA polymerase of phage SPO1 of Bacillus subtilis. The member from Thermus thermophilus HB8 is known to act as uracil-DNA glycosylase, an enzyme of DNA base excision repair. Its appearance as a domain of phage DNA polymerases could be consistent with uracil-DNA glycosylase activity.
Probab=29.54  E-value=24  Score=24.41  Aligned_cols=21  Identities=24%  Similarity=0.441  Sum_probs=17.9

Q ss_pred             HHHHhcccchhhhhhhcCcCc
Q 048473           40 TLVASARPFLRGELEAIDKNL   60 (81)
Q Consensus        40 ~lla~aRPFLRgdle~iDp~L   60 (81)
                      .-++.++|||+.+++.|.|++
T Consensus        83 ~Ei~~c~~~l~~eI~~v~P~~  103 (173)
T TIGR00758        83 EEVEACAPYLVKQIELIRPKV  103 (173)
T ss_pred             HHHHHHHHHHHHHHHhcCCCE
Confidence            447889999999999999964


No 16 
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The
Probab=26.67  E-value=36  Score=22.87  Aligned_cols=18  Identities=39%  Similarity=0.569  Sum_probs=15.6

Q ss_pred             CCCchHHHHHHhcccchh
Q 048473           33 INNDYLETLVASARPFLR   50 (81)
Q Consensus        33 ~~~~~l~~lla~aRPFLR   50 (81)
                      ..|+++...+..|+|.||
T Consensus        57 nNDdNf~kAlssa~plLR   74 (80)
T cd06403          57 NNDDNFLKALSSANPLLR   74 (80)
T ss_pred             cCcHHHHHHHHcCCCceE
Confidence            357789999999999998


No 17 
>PRK14614 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=25.76  E-value=40  Score=24.81  Aligned_cols=29  Identities=24%  Similarity=0.219  Sum_probs=23.5

Q ss_pred             cchhhhhhh----cCcCchHHHHHHHHcCCccc
Q 048473           47 PFLRGELEA----IDKNLPSLIVVLRSVGAGES   75 (81)
Q Consensus        47 PFLRgdle~----iDp~LPslisVLrS~GAgEC   75 (81)
                      .++.+|++.    ..|+|..++..+++.||--|
T Consensus       208 ~~~~ndle~~~~~~~p~l~~i~~~~~~~Galga  240 (280)
T PRK14614        208 ALLSNDLESVTIGRFPVIGEIKEELLAAGARGS  240 (280)
T ss_pred             hhcccCcHHHHHhcChHHHHHHHHHHhCCCCEE
Confidence            456799887    47999999999999998433


No 18 
>PRK11190 Fe/S biogenesis protein NfuA; Provisional
Probab=24.62  E-value=52  Score=24.08  Aligned_cols=18  Identities=22%  Similarity=0.385  Sum_probs=13.4

Q ss_pred             CchHHHHHH-hcccchhhh
Q 048473           35 NDYLETLVA-SARPFLRGE   52 (81)
Q Consensus        35 ~~~l~~lla-~aRPFLRgd   52 (81)
                      -..+..+|+ ..||+|+.|
T Consensus       108 ~~~i~~~l~~~irP~l~~d  126 (192)
T PRK11190        108 MERVEYVLQSQINPQLAGH  126 (192)
T ss_pred             HHHHHHHHHhccChhHHhc
Confidence            345677886 899999854


No 19 
>PF01106 NifU:  NifU-like domain;  InterPro: IPR001075 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] []. FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins [, ]. It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly []. The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA []. SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA [], acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins []. Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen []. This entry represents the C-terminal of NifU and homologous proteins. NifU contains two domains: an N-terminal (IPR002871 from INTERPRO) and a C-terminal domain []. These domains exist either together or on different polypeptides, both domains being found in organisms that do not fix nitrogen (e.g. yeast), so they have a broader significance in the cell than nitrogen fixation. ; GO: 0005506 iron ion binding, 0051536 iron-sulfur cluster binding, 0016226 iron-sulfur cluster assembly; PDB: 2JNV_A 2Z51_A 1TH5_A 1VEH_A 1XHJ_A.
Probab=24.54  E-value=39  Score=20.67  Aligned_cols=14  Identities=29%  Similarity=0.774  Sum_probs=11.5

Q ss_pred             HHHHHhcccchhhh
Q 048473           39 ETLVASARPFLRGE   52 (81)
Q Consensus        39 ~~lla~aRPFLRgd   52 (81)
                      +++|+..||.|+.|
T Consensus         2 ~~~l~~IrP~L~~d   15 (68)
T PF01106_consen    2 EEVLEEIRPYLQSD   15 (68)
T ss_dssp             HHHHHHCHHHHHHT
T ss_pred             HHHHHHhChHHHhc
Confidence            57788899999854


No 20 
>PRK13186 lpxC UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed
Probab=23.57  E-value=35  Score=26.91  Aligned_cols=40  Identities=30%  Similarity=0.340  Sum_probs=28.4

Q ss_pred             cceeeeeeccccccccCCCCCCCCCCCCCchHHHHHHhcccchhh
Q 048473            7 SFSFNIFFDHPLIFNQNSTMPSQLGNINNDYLETLVASARPFLRG   51 (81)
Q Consensus         7 ~~~~~~~~~~~l~f~qns~m~s~~~~~~~~~l~~lla~aRPFLRg   51 (81)
                      .+++-|-|+||.+=+|.-++.-+     .+...+-++.||=|-.-
T Consensus       153 ~i~~~idf~~~~ig~Q~~~~~~~-----~~~f~~eIa~ARTF~f~  192 (295)
T PRK13186        153 RLDFTIDFDHPAIGRQSYSLDFS-----PESFVREIARARTFGFM  192 (295)
T ss_pred             EEEEEEECCCCccceEEEEEeCC-----HHHHHHhccCCcccCcH
Confidence            44567889999998888776433     22455568999998653


No 21 
>PRK15318 intimin-like protein SinH; Provisional
Probab=23.36  E-value=32  Score=30.87  Aligned_cols=23  Identities=17%  Similarity=0.220  Sum_probs=18.8

Q ss_pred             cceeeeeeccccccccCCCCCCCC
Q 048473            7 SFSFNIFFDHPLIFNQNSTMPSQL   30 (81)
Q Consensus         7 ~~~~~~~~~~~l~f~qns~m~s~~   30 (81)
                      -+..|.||||.+. .+++|++-+.
T Consensus       171 MlG~NaFyD~d~s-~~h~R~GlGa  193 (730)
T PRK15318        171 LLGGNIFYDYDFT-RGHRRLGLGT  193 (730)
T ss_pred             EEEeEEEEccCCC-CCcceeeeee
Confidence            3678999999998 6788888773


No 22 
>PRK05362 phosphopentomutase; Provisional
Probab=23.14  E-value=47  Score=26.97  Aligned_cols=22  Identities=18%  Similarity=0.453  Sum_probs=17.6

Q ss_pred             hhhhhhcCcCchHHHHHHHHcCC
Q 048473           50 RGELEAIDKNLPSLIVVLRSVGA   72 (81)
Q Consensus        50 Rgdle~iDp~LPslisVLrS~GA   72 (81)
                      |-|+. |+|.-|.+++.|+.+|-
T Consensus       214 r~d~~-~~p~~~Tl~d~L~~aG~  235 (394)
T PRK05362        214 RHDYA-LKPPAPTVLDKLKEAGG  235 (394)
T ss_pred             cCCcC-cCCCCCCHHHHHHHCCC
Confidence            44655 88989999999998874


No 23 
>PF10691 DUF2497:  Protein of unknown function (DUF2497) ;  InterPro: IPR019632  Members of this family belong to the Alphaproteobacteria. The function of the family is not known. 
Probab=22.77  E-value=37  Score=21.84  Aligned_cols=31  Identities=42%  Similarity=0.608  Sum_probs=20.3

Q ss_pred             CchHHHHH-HhcccchhhhhhhcCcCchHHHHHHH
Q 048473           35 NDYLETLV-ASARPFLRGELEAIDKNLPSLIVVLR   68 (81)
Q Consensus        35 ~~~l~~ll-a~aRPFLRgdle~iDp~LPslisVLr   68 (81)
                      +..++.++ +.-||.|+.   =+|-+||.++.-|-
T Consensus        32 ~~TlE~lvremLRPmLke---WLD~nLP~lVErlV   63 (73)
T PF10691_consen   32 GRTLEDLVREMLRPMLKE---WLDENLPGLVERLV   63 (73)
T ss_pred             cccHHHHHHHHHHHHHHH---HHHhccHHHHHHHH
Confidence            34455544 345777763   47899999987664


No 24 
>COG3285 Predicted eukaryotic-type DNA primase [DNA replication, recombination, and repair]
Probab=22.64  E-value=27  Score=28.26  Aligned_cols=48  Identities=15%  Similarity=0.161  Sum_probs=30.3

Q ss_pred             cccccCCCCCCCCCCCCCchHHHHHHhcccchhhhhhhcC-c------CchHHHHH
Q 048473           18 LIFNQNSTMPSQLGNINNDYLETLVASARPFLRGELEAID-K------NLPSLIVV   66 (81)
Q Consensus        18 l~f~qns~m~s~~~~~~~~~l~~lla~aRPFLRgdle~iD-p------~LPslisV   66 (81)
                      +||+||+++.+.-.|+.-..- +-.-++-|.-..|++..| |      .+|++++.
T Consensus       220 lDylrN~rg~T~vapYS~Rar-~g~~Vs~Pl~W~el~~~~~p~~ft~~tvp~rl~~  274 (299)
T COG3285         220 LDYLRNARGKTAVAPYSPRAR-PGATVSTPLTWEELEGLLAPDQFTIRTVPERLAK  274 (299)
T ss_pred             EEecccCCCceeecccCccCC-CCCcccccccHHHhcCccChhhccccchHHHHHh
Confidence            579999999887444432211 123456678888888887 5      45555544


No 25 
>smart00759 Flu_M1_C Influenza Matrix protein (M1) C-terminal domain. This region is thought to be a second domain of the M1 matrix protein.
Probab=22.04  E-value=39  Score=23.57  Aligned_cols=20  Identities=35%  Similarity=0.489  Sum_probs=16.3

Q ss_pred             hcCcCchHHHHHHHHcCCcc
Q 048473           55 AIDKNLPSLIVVLRSVGAGE   74 (81)
Q Consensus        55 ~iDp~LPslisVLrS~GAgE   74 (81)
                      +|-.++.+-|.+||++||+-
T Consensus        47 eiA~qa~~mi~alRsiGahp   66 (95)
T smart00759       47 EIAEEAQQMIGALRSIGAHP   66 (95)
T ss_pred             HHHHHHHHHHHHHHHhcCCC
Confidence            45557889999999999964


No 26 
>PF12010 DUF3502:  Domain of unknown function (DUF3502);  InterPro: IPR022627  This domain is about 140 amino acids in length and is functionally uncharacterised. It is found in bacteria C-terminal to PF01547 from PFAM. 
Probab=20.53  E-value=30  Score=23.33  Aligned_cols=28  Identities=21%  Similarity=0.406  Sum_probs=22.9

Q ss_pred             cccchhhhhhhcCcCchHHHHHHHHcCCc
Q 048473           45 ARPFLRGELEAIDKNLPSLIVVLRSVGAG   73 (81)
Q Consensus        45 aRPFLRgdle~iDp~LPslisVLrS~GAg   73 (81)
                      ..|+.-|-.+ +|..||.++.-|.++|..
T Consensus        89 ~~~L~~G~vd-~e~~~~~~~~kLk~AGid  116 (134)
T PF12010_consen   89 YPPLETGLVD-PEEALPEFNEKLKAAGID  116 (134)
T ss_pred             HHHHHccCCC-HHHHHHHHHHHHHHhChH
Confidence            3667777776 778999999999999953


No 27 
>TIGR00325 lpxC UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli, LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability.
Probab=20.09  E-value=1e+02  Score=24.45  Aligned_cols=41  Identities=37%  Similarity=0.455  Sum_probs=29.5

Q ss_pred             CCc--cceeeeeeccccccccCCCCCCCCCCCCCchHHHHHHhcccch
Q 048473            4 PSS--SFSFNIFFDHPLIFNQNSTMPSQLGNINNDYLETLVASARPFL   49 (81)
Q Consensus         4 ~~~--~~~~~~~~~~~l~f~qns~m~s~~~~~~~~~l~~lla~aRPFL   49 (81)
                      |+.  +++|-|-|+||.+=+|.-++.-+     ......-++.||=|=
T Consensus       147 P~~~~~i~~~Idf~~~~ig~Q~~~~~~~-----~~~f~~eIA~ARTFg  189 (297)
T TIGR00325       147 PYNGFRLDFTIDFNHPAIGKQWYTMNFS-----AEAFATQIARARTFG  189 (297)
T ss_pred             cCCCcEEEEEEECCCCcccceEEEEeCC-----HHHHHHHhcCCceEE
Confidence            444  45678899999998998876322     235666799999993


Done!