BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048475
         (575 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1
           SV=2
          Length = 748

 Score = 32.3 bits (72), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 10/64 (15%)

Query: 292 LRCALVLLKQDDEGKEFVERIVKRLHALNYHMRSYFWLDLKQLNDIYRYKTEEYSHTAVN 351
           L CA +L K+++ G + + + VK L  +NY++  Y          I R+  E  S++ VN
Sbjct: 232 LSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKY----------ICRFLDEVQSYSGVN 281

Query: 352 KFNV 355
           K +V
Sbjct: 282 KMSV 285


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.322    0.137    0.429 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 219,870,041
Number of Sequences: 539616
Number of extensions: 9458488
Number of successful extensions: 19291
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 19288
Number of HSP's gapped (non-prelim): 4
length of query: 575
length of database: 191,569,459
effective HSP length: 123
effective length of query: 452
effective length of database: 125,196,691
effective search space: 56588904332
effective search space used: 56588904332
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)