BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 048483
(99 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1VSY|H Chain H, Proteasome Activator Complex
pdb|1VSY|V Chain V, Proteasome Activator Complex
pdb|3L5Q|B Chain B, Proteasome Activator Complex
pdb|3L5Q|D Chain D, Proteasome Activator Complex
Length = 196
Score = 25.4 bits (54), Expect = 8.6, Method: Compositional matrix adjust.
Identities = 9/30 (30%), Positives = 16/30 (53%)
Query: 5 KIWCCFKGTDEEYSIPKDVPKGHVVVYVGE 34
KIWCC G+ + D+ + H+ +Y +
Sbjct: 40 KIWCCRSGSAADTQAIADIVQYHLELYTSQ 69
>pdb|1G65|N Chain N, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|1G65|2 Chain 2, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|1G0U|N Chain N, A Gated Channel Into The Proteasome Core Particle
pdb|1G0U|2 Chain 2, A Gated Channel Into The Proteasome Core Particle
pdb|1FNT|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1FNT|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1JD2|N Chain N, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|1JD2|U Chain U, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|1Z7Q|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1Z7Q|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|2F16|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2F16|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2FAK|N Chain N, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2FAK|2 Chain 2, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2GPL|N Chain N, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|2GPL|2 Chain 2, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|2ZCY|N Chain N, Yeast 20s Proteasome:syringolin A-Complex
pdb|2ZCY|1 Chain 1, Yeast 20s Proteasome:syringolin A-Complex
pdb|3BDM|N Chain N, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3BDM|1 Chain 1, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3D29|N Chain N, Proteasome Inhibition By Fellutamide B
pdb|3D29|2 Chain 2, Proteasome Inhibition By Fellutamide B
pdb|3E47|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3E47|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3DY3|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY3|2 Chain 2, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY4|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3DY4|2 Chain 2, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3GPJ|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPJ|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPT|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPT|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPW|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3GPW|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3HYE|N Chain N, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|3HYE|2 Chain 2, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|3MG4|N Chain N, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG4|2 Chain 2, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG0|N Chain N, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3MG0|2 Chain 2, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3MG6|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG6|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG7|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG7|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG8|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|3MG8|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|3OKJ|N Chain N, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OKJ|2 Chain 2, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OEU|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEU|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEV|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3OEV|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3TDD|N Chain N, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3TDD|2 Chain 2, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3SHJ|N Chain N, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|3SHJ|2 Chain 2, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|3UN4|N Chain N, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN4|BB Chain b, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN8|N Chain N, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|3UN8|BB Chain b, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|3SDI|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDI|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDK|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|3SDK|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|4GK7|N Chain N, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4GK7|BB Chain b, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4G4S|H Chain H, Structure Of Proteasome-Pba1-Pba2 Complex
pdb|4FZC|N Chain N, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZC|BB Chain b, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZG|N Chain N, 20s Yeast Proteasome In Complex With Glidobactin
pdb|4FZG|BB Chain b, 20s Yeast Proteasome In Complex With Glidobactin
pdb|4INR|N Chain N, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INR|BB Chain b, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INT|N Chain N, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INT|BB Chain b, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INU|N Chain N, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
pdb|4INU|BB Chain b, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
Length = 196
Score = 25.4 bits (54), Expect = 8.7, Method: Compositional matrix adjust.
Identities = 9/30 (30%), Positives = 16/30 (53%)
Query: 5 KIWCCFKGTDEEYSIPKDVPKGHVVVYVGE 34
KIWCC G+ + D+ + H+ +Y +
Sbjct: 40 KIWCCRSGSAADTQAIADIVQYHLELYTSQ 69
>pdb|1RYP|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
pdb|1RYP|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
Length = 205
Score = 25.4 bits (54), Expect = 9.1, Method: Compositional matrix adjust.
Identities = 9/30 (30%), Positives = 16/30 (53%)
Query: 5 KIWCCFKGTDEEYSIPKDVPKGHVVVYVGE 34
KIWCC G+ + D+ + H+ +Y +
Sbjct: 49 KIWCCRSGSAADTQAIADIVQYHLELYTSQ 78
>pdb|3NZJ|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZJ|2 Chain 2, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZW|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZW|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZX|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
pdb|3NZX|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
pdb|4B4T|1 Chain 1, Near-Atomic Resolution Structural Model Of The Yeast 26s
Proteasome
Length = 215
Score = 25.4 bits (54), Expect = 9.2, Method: Compositional matrix adjust.
Identities = 9/30 (30%), Positives = 16/30 (53%)
Query: 5 KIWCCFKGTDEEYSIPKDVPKGHVVVYVGE 34
KIWCC G+ + D+ + H+ +Y +
Sbjct: 59 KIWCCRSGSAADTQAIADIVQYHLELYTSQ 88
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.141 0.460
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,958,063
Number of Sequences: 62578
Number of extensions: 102803
Number of successful extensions: 287
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 283
Number of HSP's gapped (non-prelim): 5
length of query: 99
length of database: 14,973,337
effective HSP length: 65
effective length of query: 34
effective length of database: 10,905,767
effective search space: 370796078
effective search space used: 370796078
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)