BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048483
         (99 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1VSY|H Chain H, Proteasome Activator Complex
 pdb|1VSY|V Chain V, Proteasome Activator Complex
 pdb|3L5Q|B Chain B, Proteasome Activator Complex
 pdb|3L5Q|D Chain D, Proteasome Activator Complex
          Length = 196

 Score = 25.4 bits (54), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 16/30 (53%)

Query: 5  KIWCCFKGTDEEYSIPKDVPKGHVVVYVGE 34
          KIWCC  G+  +     D+ + H+ +Y  +
Sbjct: 40 KIWCCRSGSAADTQAIADIVQYHLELYTSQ 69


>pdb|1G65|N Chain N, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
          Molecular Basis For Selectivity Of
          Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1G65|2 Chain 2, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
          Molecular Basis For Selectivity Of
          Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1G0U|N Chain N, A Gated Channel Into The Proteasome Core Particle
 pdb|1G0U|2 Chain 2, A Gated Channel Into The Proteasome Core Particle
 pdb|1FNT|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1FNT|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1JD2|N Chain N, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
          Complex: A Non- Covalent Proteasome Inhibitor
 pdb|1JD2|U Chain U, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
          Complex: A Non- Covalent Proteasome Inhibitor
 pdb|1Z7Q|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1Z7Q|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|2F16|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Bortezomib
 pdb|2F16|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Bortezomib
 pdb|2FAK|N Chain N, Crystal Structure Of Salinosporamide A In Complex With
          The Yeast 20s Proteasome
 pdb|2FAK|2 Chain 2, Crystal Structure Of Salinosporamide A In Complex With
          The Yeast 20s Proteasome
 pdb|2GPL|N Chain N, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
          Proteasome Inhibitors
 pdb|2GPL|2 Chain 2, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
          Proteasome Inhibitors
 pdb|2ZCY|N Chain N, Yeast 20s Proteasome:syringolin A-Complex
 pdb|2ZCY|1 Chain 1, Yeast 20s Proteasome:syringolin A-Complex
 pdb|3BDM|N Chain N, Yeast 20s Proteasome:glidobactin A-Complex
 pdb|3BDM|1 Chain 1, Yeast 20s Proteasome:glidobactin A-Complex
 pdb|3D29|N Chain N, Proteasome Inhibition By Fellutamide B
 pdb|3D29|2 Chain 2, Proteasome Inhibition By Fellutamide B
 pdb|3E47|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Homobelactosin C
 pdb|3E47|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Homobelactosin C
 pdb|3DY3|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex
          With The Epimer Form Of Spirolactacystin
 pdb|3DY3|2 Chain 2, Crystal Structure Of Yeast 20s Proteasome In Complex
          With The Epimer Form Of Spirolactacystin
 pdb|3DY4|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Spirolactacystin
 pdb|3DY4|2 Chain 2, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Spirolactacystin
 pdb|3GPJ|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Syringolin B
 pdb|3GPJ|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Syringolin B
 pdb|3GPT|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPT|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPW|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Irreversible
          Inhibitor Ligand
 pdb|3GPW|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Irreversible
          Inhibitor Ligand
 pdb|3HYE|N Chain N, Crystal Structure Of 20s Proteasome In Complex With
          Hydroxylated Salinosporamide
 pdb|3HYE|2 Chain 2, Crystal Structure Of 20s Proteasome In Complex With
          Hydroxylated Salinosporamide
 pdb|3MG4|N Chain N, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG4|2 Chain 2, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG0|N Chain N, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3MG0|2 Chain 2, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3MG6|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 6
 pdb|3MG6|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 6
 pdb|3MG7|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 8
 pdb|3MG7|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 8
 pdb|3MG8|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 16
 pdb|3MG8|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 16
 pdb|3OKJ|N Chain N, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
          Lead Structure Motif For Proteasome Inhibition
 pdb|3OKJ|2 Chain 2, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
          Lead Structure Motif For Proteasome Inhibition
 pdb|3OEU|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 24
 pdb|3OEU|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 24
 pdb|3OEV|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 25
 pdb|3OEV|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 25
 pdb|3TDD|N Chain N, Crystal Structure Of Yeast Cp In Complex With Belactosin
          C
 pdb|3TDD|2 Chain 2, Crystal Structure Of Yeast Cp In Complex With Belactosin
          C
 pdb|3SHJ|N Chain N, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|3SHJ|2 Chain 2, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|3UN4|N Chain N, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN4|BB Chain b, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN8|N Chain N, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|3UN8|BB Chain b, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|3SDI|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 20
 pdb|3SDI|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 20
 pdb|3SDK|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 34
 pdb|3SDK|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 34
 pdb|4GK7|N Chain N, Yeast 20s Proteasome In Complex With The
          Syringolin-Glidobactin Chimera
 pdb|4GK7|BB Chain b, Yeast 20s Proteasome In Complex With The
          Syringolin-Glidobactin Chimera
 pdb|4G4S|H Chain H, Structure Of Proteasome-Pba1-Pba2 Complex
 pdb|4FZC|N Chain N, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZC|BB Chain b, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZG|N Chain N, 20s Yeast Proteasome In Complex With Glidobactin
 pdb|4FZG|BB Chain b, 20s Yeast Proteasome In Complex With Glidobactin
 pdb|4INR|N Chain N, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu102
 pdb|4INR|BB Chain b, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu102
 pdb|4INT|N Chain N, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu122
 pdb|4INT|BB Chain b, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu122
 pdb|4INU|N Chain N, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu112
 pdb|4INU|BB Chain b, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu112
          Length = 196

 Score = 25.4 bits (54), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 16/30 (53%)

Query: 5  KIWCCFKGTDEEYSIPKDVPKGHVVVYVGE 34
          KIWCC  G+  +     D+ + H+ +Y  +
Sbjct: 40 KIWCCRSGSAADTQAIADIVQYHLELYTSQ 69


>pdb|1RYP|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast At
          2.4 Angstroms Resolution
 pdb|1RYP|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast At
          2.4 Angstroms Resolution
          Length = 205

 Score = 25.4 bits (54), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 16/30 (53%)

Query: 5  KIWCCFKGTDEEYSIPKDVPKGHVVVYVGE 34
          KIWCC  G+  +     D+ + H+ +Y  +
Sbjct: 49 KIWCCRSGSAADTQAIADIVQYHLELYTSQ 78


>pdb|3NZJ|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Ligand 2a
 pdb|3NZJ|2 Chain 2, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Ligand 2a
 pdb|3NZW|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With 2b
 pdb|3NZW|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With 2b
 pdb|3NZX|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Ligand 2c
 pdb|3NZX|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Ligand 2c
 pdb|4B4T|1 Chain 1, Near-Atomic Resolution Structural Model Of The Yeast 26s
          Proteasome
          Length = 215

 Score = 25.4 bits (54), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 16/30 (53%)

Query: 5  KIWCCFKGTDEEYSIPKDVPKGHVVVYVGE 34
          KIWCC  G+  +     D+ + H+ +Y  +
Sbjct: 59 KIWCCRSGSAADTQAIADIVQYHLELYTSQ 88


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.141    0.460 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,958,063
Number of Sequences: 62578
Number of extensions: 102803
Number of successful extensions: 287
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 283
Number of HSP's gapped (non-prelim): 5
length of query: 99
length of database: 14,973,337
effective HSP length: 65
effective length of query: 34
effective length of database: 10,905,767
effective search space: 370796078
effective search space used: 370796078
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)