Citrus Sinensis ID: 048514

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MEKSPDNIPDQHFINLVVKGQDNDPLYFEFRRDWEIKKLLITYCEKKDAQYGTFPFLINGNRFPHIRTPDQLGLKDGDEIVATFYAGGA
ccccccccccccEEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHccccccEEEEEEccCEccccccccccccccccEEEEEEEcccc
***********HFINLVVKGQDNDPLYFEFRRDWEIKKLLITYCEKKDAQYGTFPFLINGNRFPHIRTPDQLGLKDGDEIVATFYAGG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKSPDNIPDQHFINLVVKGQDNDPLYFEFRRDWEIKKLLITYCEKKDAQYGTFPFLINGNRFPHIRTPDQLGLKDGDEIVATFYAGGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Small ubiquitin-related modifier 2 Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Required for the massive protein sumoylation in the nucleus induced by heat shock and controlled by SIZ1.probableQ9FLP6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KYD, chain D
Confidence level:very confident
Coverage over the Query: 12-88
View the alignment between query and template
View the model in PyMOL