BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 048536
(267 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3JSU|A Chain A, Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium
Falciparum Dihydrofolate Reductase-Thymidylate
Synthase(Pfdhfr-Ts) Complexed With Qn254, Nadph, And
Dump
pdb|3JSU|B Chain B, Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium
Falciparum Dihydrofolate Reductase-Thymidylate
Synthase(Pfdhfr-Ts) Complexed With Qn254, Nadph, And
Dump
pdb|3QG2|A Chain A, Plasmodium Falciparum Dhfr-Ts Qradruple Mutant
(N51i+c59r+s108n+i164l, V1S) PYRIMETHAMINE COMPLEX
pdb|3QG2|B Chain B, Plasmodium Falciparum Dhfr-Ts Qradruple Mutant
(N51i+c59r+s108n+i164l, V1S) PYRIMETHAMINE COMPLEX
pdb|4DP3|A Chain A, Quadruple Mutant (N51i+c59r+s108n+i164l) Plasmodium
Falciparum Dihydrofolate Reductase-Thymidylate Synthase
(Pfdhfr-Ts) Complexed With P218 And Nadph
pdb|4DP3|B Chain B, Quadruple Mutant (N51i+c59r+s108n+i164l) Plasmodium
Falciparum Dihydrofolate Reductase-Thymidylate Synthase
(Pfdhfr-Ts) Complexed With P218 And Nadph
pdb|4DPH|A Chain A, Quadruple Mutant (N51i+c59r+s108n+i164l) Plasmodium
Falciparum Dihydrofolate Reductase-Thymidylate Synthase
(Pfdhfr-Ts) Complexed With P65 And Nadph
pdb|4DPH|B Chain B, Quadruple Mutant (N51i+c59r+s108n+i164l) Plasmodium
Falciparum Dihydrofolate Reductase-Thymidylate Synthase
(Pfdhfr-Ts) Complexed With P65 And Nadph
Length = 608
Score = 27.3 bits (59), Expect = 9.0, Method: Compositional matrix adjust.
Identities = 14/42 (33%), Positives = 22/42 (52%)
Query: 115 QWKDMGWQGPNPSTDFRGCGFISLENLLFLAKNYPASFQRLL 156
QW+ G + N ++ G L+N++ L KN P S + LL
Sbjct: 433 QWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILL 474
>pdb|3QGT|A Chain A, Crystal Structure Of Wild-Type Pfdhfr-Ts Complexed With
Nadph, Dump And Pyrimethamine
pdb|3QGT|B Chain B, Crystal Structure Of Wild-Type Pfdhfr-Ts Complexed With
Nadph, Dump And Pyrimethamine
pdb|3UM8|A Chain A, Wild-Type Plasmodium Falciparum Dhfr-Ts Complexed With
Cycloguanil And Nadph
pdb|3UM8|B Chain B, Wild-Type Plasmodium Falciparum Dhfr-Ts Complexed With
Cycloguanil And Nadph
pdb|4DPD|A Chain A, Wild Type Plasmodium Falciparum Dihydrofolate
Reductase-Thymidylate Synthase (Pfdhfr-Ts), Dhf Complex,
Nadp+, Dump
pdb|4DPD|B Chain B, Wild Type Plasmodium Falciparum Dihydrofolate
Reductase-Thymidylate Synthase (Pfdhfr-Ts), Dhf Complex,
Nadp+, Dump
Length = 608
Score = 27.3 bits (59), Expect = 9.4, Method: Compositional matrix adjust.
Identities = 14/42 (33%), Positives = 22/42 (52%)
Query: 115 QWKDMGWQGPNPSTDFRGCGFISLENLLFLAKNYPASFQRLL 156
QW+ G + N ++ G L+N++ L KN P S + LL
Sbjct: 433 QWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILL 474
>pdb|3UM5|A Chain A, Double Mutant (A16v+s108t) Plasmodium Falciparum
Dihydrofolate Reductase-Thymidylate Synthase
(Pfdhfr-Ts-T994) COMPLEXED WITH Pyrimethamine, Nadph,
And Dump
pdb|3UM5|B Chain B, Double Mutant (A16v+s108t) Plasmodium Falciparum
Dihydrofolate Reductase-Thymidylate Synthase
(Pfdhfr-Ts-T994) COMPLEXED WITH Pyrimethamine, Nadph,
And Dump
pdb|3UM6|A Chain A, Double Mutant (A16v+s108t) Plasmodium Falciparum Dhfr-Ts
(T994) Complexed With Cycloguanil, Nadph And Dump
pdb|3UM6|B Chain B, Double Mutant (A16v+s108t) Plasmodium Falciparum Dhfr-Ts
(T994) Complexed With Cycloguanil, Nadph And Dump
Length = 608
Score = 27.3 bits (59), Expect = 9.7, Method: Compositional matrix adjust.
Identities = 14/42 (33%), Positives = 22/42 (52%)
Query: 115 QWKDMGWQGPNPSTDFRGCGFISLENLLFLAKNYPASFQRLL 156
QW+ G + N ++ G L+N++ L KN P S + LL
Sbjct: 433 QWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILL 474
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.138 0.440
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,177,977
Number of Sequences: 62578
Number of extensions: 307015
Number of successful extensions: 533
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 529
Number of HSP's gapped (non-prelim): 6
length of query: 267
length of database: 14,973,337
effective HSP length: 97
effective length of query: 170
effective length of database: 8,903,271
effective search space: 1513556070
effective search space used: 1513556070
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.9 bits)