Query         048574
Match_columns 65
No_of_seqs    102 out of 215
Neff          3.4 
Searched_HMMs 46136
Date          Fri Mar 29 10:47:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048574.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048574hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04398 DUF538:  Protein of un  99.6 1.2E-15 2.6E-20   99.6   3.6   38   21-58      1-38  (110)
  2 PF09351 DUF1993:  Domain of un  65.6       3 6.4E-05   28.7   0.8   14   21-34    143-156 (162)
  3 smart00540 LEM in nuclear memb  58.8     8.1 0.00018   21.9   1.7   18   19-36      8-25  (44)
  4 PF10262 Rdx:  Rdx family;  Int  55.2      12 0.00027   22.0   2.2   13   48-60     41-53  (76)
  5 PF06742 DUF1214:  Protein of u  49.4      19 0.00041   21.8   2.4   25   35-59     51-76  (103)
  6 KOG2455 Delta-1-pyrroline-5-ca  47.9      12 0.00025   31.2   1.6   16   21-36    241-256 (561)
  7 PF05345 He_PIG:  Putative Ig d  45.4      20 0.00044   20.0   1.9   18   29-54     10-27  (49)
  8 KOG3591 Alpha crystallins [Pos  43.5      18 0.00038   25.2   1.8   30   25-56    117-146 (173)
  9 PF15117 UPF0697:  Uncharacteri  41.4      37 0.00081   22.5   3.0   26    4-29     40-67  (99)
 10 PF15537 Toxin_59:  Putative to  37.2      29 0.00064   23.9   2.0   27   24-56     41-67  (125)
 11 cd04911 ACT_AKiii-YclM-BS_1 AC  37.2      35 0.00076   21.1   2.2   32   22-53     21-52  (76)
 12 PRK05231 homoserine kinase; Pr  36.2      75  0.0016   22.2   4.0   39   20-58     10-54  (319)
 13 TIGR00938 thrB_alt homoserine   35.9      63  0.0014   22.7   3.6   43   17-59      7-55  (307)
 14 PRK09293 fructose-1,6-bisphosp  35.9      34 0.00074   26.0   2.4   18   38-55    170-187 (327)
 15 PF09949 DUF2183:  Uncharacteri  35.9      19 0.00042   22.9   0.9   16   20-35     14-29  (100)
 16 PF00316 FBPase:  Fructose-1-6-  35.0      28 0.00061   26.6   1.8   17   38-54    169-185 (324)
 17 PF11426 Tn7_TnsC_Int:  Tn7 tra  34.6      32  0.0007   19.9   1.7   15   17-31     22-36  (48)
 18 cd04483 hOBFC1_like hOBFC1_lik  34.2      43 0.00092   20.7   2.3   19   41-59     16-34  (92)
 19 TIGR02503 type_III_SycN type I  34.2      76  0.0016   21.4   3.6   40   20-60      3-42  (119)
 20 PLN02262 fructose-1,6-bisphosp  34.1      34 0.00073   26.4   2.1   18   38-55    182-199 (340)
 21 smart00469 WIF Wnt-inhibitory   33.0      67  0.0014   22.1   3.3   35   24-58     71-113 (136)
 22 PRK10713 2Fe-2S ferredoxin Yfa  33.0      74  0.0016   19.0   3.1   16   18-33     18-33  (84)
 23 cd00354 FBPase Fructose-1,6-bi  32.7      36 0.00079   25.7   2.1   18   38-55    163-180 (315)
 24 PLN02628 fructose-1,6-bisphosp  32.6      38 0.00081   26.4   2.2   18   38-55    192-209 (351)
 25 PF14567 SUKH_5:  SMI1-KNR4 cel  32.4      18  0.0004   24.4   0.4   30   21-51     73-105 (132)
 26 cd01781 AF6_RA_repeat2 Ubiquit  31.1      30 0.00064   22.7   1.2   25   20-48     30-54  (100)
 27 cd07102 ALDH_EDX86601 Uncharac  31.1      32 0.00068   25.8   1.5   16   21-36    161-176 (452)
 28 cd04934 ACT_AK-Hom3_1 CT domai  30.8      35 0.00077   20.1   1.4   32   20-51     19-50  (73)
 29 cd04890 ACT_AK-like_1 ACT doma  30.4      40 0.00087   18.2   1.5   25   20-44     18-42  (62)
 30 PRK08364 sulfur carrier protei  29.9      72  0.0016   18.5   2.7   17   17-33     21-37  (70)
 31 cd07147 ALDH_F21_RNP123 Aldehy  29.6      35 0.00075   25.7   1.5   16   21-36    168-183 (452)
 32 cd07090 ALDH_F9_TMBADH NAD+-de  29.6      34 0.00073   25.9   1.5   16   21-36    161-176 (457)
 33 PLN02542 fructose-1,6-bisphosp  29.6      43 0.00092   26.8   2.1   18   38-55    259-276 (412)
 34 cd07104 ALDH_BenzADH-like ALDH  29.6      34 0.00073   25.4   1.5   15   22-36    145-159 (431)
 35 TIGR02689 ars_reduc_gluta arse  28.9      40 0.00087   21.3   1.5   38   17-56     40-78  (126)
 36 COG1246 ArgA N-acetylglutamate  28.9      26 0.00057   24.5   0.7   36   16-51      8-50  (153)
 37 COG2104 ThiS Sulfur transfer p  28.9      53  0.0011   19.7   2.0   15   19-33     17-31  (68)
 38 cd07101 ALDH_SSADH2_GabD2 Myco  27.7      38 0.00082   25.6   1.5   16   21-36    163-178 (454)
 39 PF03975 CheD:  CheD chemotacti  27.4      85  0.0019   19.9   2.9   40   20-62     67-112 (114)
 40 PF03020 LEM:  LEM domain;  Int  27.4      16 0.00035   20.7  -0.4   20   17-36      6-25  (43)
 41 cd07091 ALDH_F1-2_Ald2-like AL  27.4      39 0.00084   25.7   1.5   16   21-36    186-201 (476)
 42 cd07131 ALDH_AldH-CAJ73105 Unc  27.3      40 0.00086   25.6   1.5   16   21-36    180-195 (478)
 43 cd07119 ALDH_BADH-GbsA Bacillu  27.2      40 0.00087   25.7   1.5   16   21-36    179-194 (482)
 44 PF14974 DUF4511:  Domain of un  27.0      40 0.00087   22.3   1.3   11   23-33     54-64  (105)
 45 cd04478 RPA2_DBD_D RPA2_DBD_D:  26.7      80  0.0017   18.5   2.5   21   39-59     16-36  (95)
 46 PF02772 S-AdoMet_synt_M:  S-ad  26.3      32  0.0007   23.0   0.8   23   28-52     98-120 (120)
 47 cd07144 ALDH_ALD2-YMR170C Sacc  25.9      42  0.0009   25.7   1.4   16   21-36    189-204 (484)
 48 cd07110 ALDH_F10_BADH Arabidop  25.6      44 0.00096   25.2   1.5   16   21-36    165-180 (456)
 49 COG2706 3-carboxymuconate cycl  25.6      52  0.0011   25.9   1.9   17   39-55     65-81  (346)
 50 cd07151 ALDH_HBenzADH NADP+-de  25.6      45 0.00098   25.4   1.5   15   22-36    177-191 (465)
 51 cd07093 ALDH_F8_HMSADH Human a  25.4      48   0.001   24.9   1.6   17   21-37    162-178 (455)
 52 PRK06437 hypothetical protein;  25.3      74  0.0016   18.5   2.2   17   17-33     18-34  (67)
 53 PLN02766 coniferyl-aldehyde de  25.3      44 0.00096   26.0   1.5   16   21-36    203-218 (501)
 54 PRK13968 putative succinate se  25.2      44 0.00096   25.6   1.4   15   22-36    172-186 (462)
 55 cd07138 ALDH_CddD_SSP0762 Rhod  25.2      46   0.001   25.2   1.5   16   21-36    175-190 (466)
 56 PF03990 DUF348:  Domain of unk  25.1      76  0.0016   16.9   2.0   18   17-34     15-32  (43)
 57 PRK13488 chemoreceptor glutami  24.8 1.7E+02  0.0038   20.0   4.2   37   20-59    110-152 (157)
 58 PRK10090 aldehyde dehydrogenas  24.8      46 0.00099   25.3   1.5   16   21-36    116-131 (409)
 59 cd07088 ALDH_LactADH-AldA Esch  24.8      47   0.001   25.1   1.5   16   21-36    178-193 (468)
 60 TIGR02299 HpaE 5-carboxymethyl  24.6      43 0.00094   25.6   1.3   16   21-36    180-195 (488)
 61 PF01336 tRNA_anti-codon:  OB-f  24.5      73  0.0016   17.2   1.9   20   39-58     16-35  (75)
 62 cd07105 ALDH_SaliADH Salicylal  24.5      49  0.0011   24.9   1.5   16   21-36    143-158 (432)
 63 PRK05863 sulfur carrier protei  24.4      80  0.0017   18.0   2.1   36   18-54     14-58  (65)
 64 TIGR02174 CXXU_selWTH selT/sel  24.1      70  0.0015   18.8   1.9   15   45-59     36-50  (72)
 65 cd07114 ALDH_DhaS Uncharacteri  24.0      49  0.0011   25.0   1.5   16   21-36    164-179 (457)
 66 cd07115 ALDH_HMSADH_HapE Pseud  23.9      46   0.001   25.1   1.3   17   21-37    162-178 (453)
 67 cd07118 ALDH_SNDH Gluconobacte  23.8      51  0.0011   25.0   1.6   16   21-36    164-179 (454)
 68 PRK09406 gabD1 succinic semial  23.7      49  0.0011   25.3   1.5   16   21-36    168-183 (457)
 69 TIGR03216 OH_muco_semi_DH 2-hy  23.7      51  0.0011   25.2   1.6   16   21-36    184-199 (481)
 70 PF02760 HIN:  HIN-200/IF120x d  23.3      69  0.0015   23.1   2.0   20   41-60    132-151 (170)
 71 cd07113 ALDH_PADH_NahF Escheri  23.2      53  0.0011   25.1   1.5   16   21-36    187-202 (477)
 72 cd07103 ALDH_F5_SSADH_GabD Mit  23.1      51  0.0011   24.6   1.4   16   21-36    162-177 (451)
 73 PRK13495 chemoreceptor glutami  23.0 1.5E+02  0.0032   20.4   3.6   39   20-61    108-152 (159)
 74 PRK13490 chemoreceptor glutami  22.9 1.4E+02  0.0031   20.5   3.5   38   20-60    115-158 (162)
 75 PF11823 DUF3343:  Protein of u  22.8      20 0.00044   20.8  -0.6   26   13-38      8-33  (73)
 76 cd07150 ALDH_VaniDH_like Pseud  22.8      53  0.0012   24.6   1.4   16   21-36    164-179 (451)
 77 cd04492 YhaM_OBF_like YhaM_OBF  22.6   1E+02  0.0022   16.9   2.3   21   40-60     20-40  (83)
 78 PRK09407 gabD2 succinic semial  22.6      52  0.0011   25.7   1.4   16   21-36    199-214 (524)
 79 cd07152 ALDH_BenzADH NAD-depen  22.5      54  0.0012   24.7   1.5   15   22-36    157-171 (443)
 80 cd07109 ALDH_AAS00426 Uncharac  22.5      56  0.0012   24.7   1.5   16   21-36    162-177 (454)
 81 PF02655 ATP-grasp_3:  ATP-gras  22.4      99  0.0021   20.1   2.5   32   21-55      6-37  (161)
 82 cd07112 ALDH_GABALDH-PuuC Esch  22.3      56  0.0012   24.9   1.5   17   21-37    169-185 (462)
 83 cd07089 ALDH_CddD-AldA-like Rh  22.3      56  0.0012   24.9   1.5   16   21-36    168-183 (459)
 84 cd04485 DnaE_OBF DnaE_OBF: A s  22.0 1.2E+02  0.0027   16.2   2.6   21   41-61     21-41  (84)
 85 cd02410 archeal_CPSF_KH The ar  22.0   1E+02  0.0022   21.5   2.6   32   19-56     51-84  (145)
 86 cd07143 ALDH_AldA_AN0554 Asper  21.9      57  0.0012   25.2   1.5   17   21-37    189-205 (481)
 87 cd07111 ALDH_F16 Aldehyde dehy  21.7      55  0.0012   25.4   1.4   16   21-36    192-207 (480)
 88 cd07139 ALDH_AldA-Rv0768 Mycob  21.3      62  0.0013   24.6   1.6   16   21-36    182-197 (471)
 89 COG3812 Uncharacterized protei  21.2      52  0.0011   24.1   1.1   16   20-35    171-186 (193)
 90 TIGR02904 spore_ysxE spore coa  21.0 1.4E+02   0.003   21.1   3.2   36   24-59      3-39  (309)
 91 PF01011 PQQ:  PQQ enzyme repea  20.9      80  0.0017   16.0   1.5   12   42-53     12-23  (38)
 92 PF02983 Pro_Al_protease:  Alph  20.7 1.2E+02  0.0025   17.6   2.4   23   36-58     21-43  (62)
 93 PF11213 DUF3006:  Protein of u  20.3      26 0.00056   20.7  -0.5   29   27-55     21-51  (71)
 94 cd07149 ALDH_y4uC Uncharacteri  20.2      67  0.0014   24.0   1.5   16   22-37    169-184 (453)
 95 cd07083 ALDH_P5CDH ALDH subfam  20.1      68  0.0015   24.8   1.6   16   21-36    199-214 (500)
 96 cd07148 ALDH_RL0313 Uncharacte  20.1      67  0.0014   24.4   1.5   16   21-36    169-184 (455)
 97 cd07097 ALDH_KGSADH-YcbD Bacil  20.1      67  0.0014   24.5   1.5   16   21-36    180-195 (473)
 98 cd07100 ALDH_SSADH1_GabD1 Myco  20.1      67  0.0015   24.2   1.5   17   21-37    141-157 (429)
 99 PF03646 FlaG:  FlaG protein;    20.1      74  0.0016   19.6   1.5   19   41-59     57-75  (107)

No 1  
>PF04398 DUF538:  Protein of unknown function, DUF538;  InterPro: IPR007493 This family consists of several plant proteins of unknown function.; PDB: 1YDU_A.
Probab=99.58  E-value=1.2e-15  Score=99.60  Aligned_cols=38  Identities=45%  Similarity=0.809  Sum_probs=28.8

Q ss_pred             CHHHHHhhCCCCCcCCCCCcceeEeeCCCCcEEEEech
Q 048574           21 SAYDVLQEYDFPVGILPKGVTRYALNAETGELIFGTYE   58 (65)
Q Consensus        21 t~yelL~~ygLP~GLLP~gV~~Y~Ld~~tG~F~V~~y~   58 (65)
                      ||||+|++||||+||||++|++|+||++||.|+|++-.
T Consensus         1 tayelL~~~glP~GLLP~~v~~y~l~~~tG~f~v~l~~   38 (110)
T PF04398_consen    1 TAYELLEEYGLPRGLLPLGVTEYGLNRDTGFFWVKLKS   38 (110)
T ss_dssp             --HHHHHHHS-TT-TTTSSS-EEEE-TTT-SEEEE-SS
T ss_pred             CHHHhHHHcCCCCCcCCCCceEEEEecCCcEEEEEecC
Confidence            68999999999999999999999999999999999854


No 2  
>PF09351 DUF1993:  Domain of unknown function (DUF1993);  InterPro: IPR018531  This family of proteins are functionally uncharacterised. ; PDB: 2OQM_C 3QTH_A.
Probab=65.60  E-value=3  Score=28.70  Aligned_cols=14  Identities=36%  Similarity=0.821  Sum_probs=9.7

Q ss_pred             CHHHHHhhCCCCCc
Q 048574           21 SAYDVLQEYDFPVG   34 (65)
Q Consensus        21 t~yelL~~ygLP~G   34 (65)
                      |+|.+||..|.|.|
T Consensus       143 tAYaILR~~GV~lG  156 (162)
T PF09351_consen  143 TAYAILRHKGVPLG  156 (162)
T ss_dssp             HHHHHHHHCT----
T ss_pred             HHHHHHHhcCCCCC
Confidence            89999999999988


No 3  
>smart00540 LEM in nuclear membrane-associated proteins. LEM, domain in nuclear membrane-associated proteins, including lamino-associated polypeptide 2 and emerin.
Probab=58.76  E-value=8.1  Score=21.89  Aligned_cols=18  Identities=22%  Similarity=0.514  Sum_probs=14.2

Q ss_pred             CCCHHHHHhhCCCCCcCC
Q 048574           19 EPSAYDVLQEYDFPVGIL   36 (65)
Q Consensus        19 ~~t~yelL~~ygLP~GLL   36 (65)
                      ...+.+.|.+||+|.|=+
T Consensus         8 d~eL~~~L~~~G~~~gPI   25 (44)
T smart00540        8 DAELRAELKQYGLPPGPI   25 (44)
T ss_pred             HHHHHHHHHHcCCCCCCc
Confidence            346788999999999843


No 4  
>PF10262 Rdx:  Rdx family;  InterPro: IPR011893 This entry represents the Rdx family of selenoproteins, which includes mammalian selenoproteins SelW, SelV, SelT and SelH, bacterial SelW-like proteins and cysteine-containing proteins of unknown function in all three domains of life. Mammalian Rdx12 and its fish selenoprotein orthologues are also members of this family []. These proteins possess a thioredoxin-like fold and a conserved CXXC or CxxU (U is selenocysteine) motif near the N terminus, suggesting a redox function. Rdx proteins can use catalytic cysteine (or selenocysteine) to form transient mixed disulphides with substrate proteins. Selenium (Se) plays an essential role in cell survival and most of the effects of Se are probably mediated by selenoproteins.   Selenoprotein W (SelW) plays an important role in protection of neurons from oxidative stress during neuronal development [], [].   Selenoprotein T (SelT) is conserved from plants to humans. SelT is localized to the endoplasmic reticulum through a hydrophobic domain. The protein binds to UDP-glucose:glycoprotein glucosyltransferase (UGTR), the endoplasmic reticulum (ER)-resident protein, which is known to be involved in the quality control of protein folding [, ]. The function of SelT is unknown, although it may have a role in PACAP signaling during PC12 cell differentiation [, ].  Selenoprotein H (SelH) protects neurons against UVB-induced damage by inhibiting apoptotic cell death pathways, by preventing mitochondrial depolarization, and by promoting cell survival pathways [].; GO: 0008430 selenium binding, 0045454 cell redox homeostasis; PDB: 2OJL_B 2FA8_A 2P0G_C 2NPB_A 3DEX_C 2OKA_A 2OBK_G.
Probab=55.23  E-value=12  Score=22.01  Aligned_cols=13  Identities=15%  Similarity=0.143  Sum_probs=9.3

Q ss_pred             CCCcEEEEechhh
Q 048574           48 ETGELIFGTYEQQ   60 (65)
Q Consensus        48 ~tG~F~V~~y~~~   60 (65)
                      .+|.|+|.+-++.
T Consensus        41 ~~G~FEV~v~g~l   53 (76)
T PF10262_consen   41 STGAFEVTVNGEL   53 (76)
T ss_dssp             STT-EEEEETTEE
T ss_pred             cCCEEEEEEccEE
Confidence            5799999987653


No 5  
>PF06742 DUF1214:  Protein of unknown function (DUF1214);  InterPro: IPR010621 This entry represents the C-terminal domain of several hypothetical proteins of unknown function. ; PDB: 3U07_A 3VB9_D 2P3Y_A.
Probab=49.40  E-value=19  Score=21.75  Aligned_cols=25  Identities=20%  Similarity=0.553  Sum_probs=12.9

Q ss_pred             CCCCCcceeEee-CCCCcEEEEechh
Q 048574           35 ILPKGVTRYALN-AETGELIFGTYEQ   59 (65)
Q Consensus        35 LLP~gV~~Y~Ld-~~tG~F~V~~y~~   59 (65)
                      +.|.....++++ +.+|+|+|.+=.+
T Consensus        51 ~~~~~~~~~~i~~~~DGsf~i~ls~~   76 (103)
T PF06742_consen   51 LVPNDLNRYSINSDADGSFTITLSPE   76 (103)
T ss_dssp             B---TTS--EEETTTTSEEEEEEESS
T ss_pred             cccccccccccccCCCccEEEEEeCC
Confidence            444434445443 5679999987543


No 6  
>KOG2455 consensus Delta-1-pyrroline-5-carboxylate dehydrogenase [Amino acid transport and metabolism]
Probab=47.89  E-value=12  Score=31.19  Aligned_cols=16  Identities=31%  Similarity=0.735  Sum_probs=14.0

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+|++|++-|||.|++
T Consensus       241 ii~~il~EAGlP~Gvi  256 (561)
T KOG2455|consen  241 IIYRILREAGLPPGVI  256 (561)
T ss_pred             HHHHHHHHcCCCccce
Confidence            3799999999999975


No 7  
>PF05345 He_PIG:  Putative Ig domain;  InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins. Sequence similarities to Hyalin (IPR003410 from INTERPRO) and the PKD domain (IPR000601 from INTERPRO) suggest an Ig-like fold so this family may be similar in function to the (IPR003791 from INTERPRO) and (IPR003790 from INTERPRO) protein families.
Probab=45.36  E-value=20  Score=19.99  Aligned_cols=18  Identities=28%  Similarity=0.495  Sum_probs=10.9

Q ss_pred             CCCCCcCCCCCcceeEeeCCCCcEEE
Q 048574           29 YDFPVGILPKGVTRYALNAETGELIF   54 (65)
Q Consensus        29 ygLP~GLLP~gV~~Y~Ld~~tG~F~V   54 (65)
                      .+||.||        +||..+|.++-
T Consensus        10 ~~LP~gL--------s~d~~tG~isG   27 (49)
T PF05345_consen   10 GGLPSGL--------SLDPSTGTISG   27 (49)
T ss_pred             CCCCCcE--------EEeCCCCEEEe
Confidence            4667666        45666666653


No 8  
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones]
Probab=43.45  E-value=18  Score=25.21  Aligned_cols=30  Identities=27%  Similarity=0.526  Sum_probs=25.4

Q ss_pred             HHhhCCCCCcCCCCCcceeEeeCCCCcEEEEe
Q 048574           25 VLQEYDFPVGILPKGVTRYALNAETGELIFGT   56 (65)
Q Consensus        25 lL~~ygLP~GLLP~gV~~Y~Ld~~tG~F~V~~   56 (65)
                      .-|+|-||.|.=|..|++ +|+.+ |.++|.-
T Consensus       117 F~R~y~LP~~vdp~~V~S-~LS~d-GvLtI~a  146 (173)
T KOG3591|consen  117 FVRKYLLPEDVDPTSVTS-TLSSD-GVLTIEA  146 (173)
T ss_pred             EEEEecCCCCCChhheEE-eeCCC-ceEEEEc
Confidence            457899999999999998 78864 9999973


No 9  
>PF15117 UPF0697:  Uncharacterised protein family UPF0697   
Probab=41.43  E-value=37  Score=22.53  Aligned_cols=26  Identities=42%  Similarity=0.542  Sum_probs=19.0

Q ss_pred             eeEeeeec--ccccCCCCCCHHHHHhhC
Q 048574            4 IKINRITS--PFASADSEPSAYDVLQEY   29 (65)
Q Consensus         4 ~~~~~~~~--~~~s~~~~~t~yelL~~y   29 (65)
                      -||.||++  +...+.+.|..||-+.+-
T Consensus        40 rkImRifs~ppt~~~~~epnfyd~~~ki   67 (99)
T PF15117_consen   40 RKIMRIFSVPPTAETLTEPNFYDSMSKI   67 (99)
T ss_pred             ceEEEEEecCCCCCCCCCCcHHHHHHHH
Confidence            47899988  344467788999987653


No 10 
>PF15537 Toxin_59:  Putative toxin 59
Probab=37.25  E-value=29  Score=23.92  Aligned_cols=27  Identities=19%  Similarity=0.575  Sum_probs=22.1

Q ss_pred             HHHhhCCCCCcCCCCCcceeEeeCCCCcEEEEe
Q 048574           24 DVLQEYDFPVGILPKGVTRYALNAETGELIFGT   56 (65)
Q Consensus        24 elL~~ygLP~GLLP~gV~~Y~Ld~~tG~F~V~~   56 (65)
                      ..+++|+      |++-..|.||++++.|.|-.
T Consensus        41 ~avrNy~------p~G~~eFVFDP~~~~Fa~G~   67 (125)
T PF15537_consen   41 KAVRNYY------PSGSIEFVFDPKTNRFAVGS   67 (125)
T ss_pred             hHHhccC------CCCCccEEEcCCcCeEeecC
Confidence            4567775      58888999999999998854


No 11 
>cd04911 ACT_AKiii-YclM-BS_1 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII. This CD includes the first of two ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis (BS) YclM) and Clostridia species. Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. Bacillus subtilis YclM is reported to be a single polypeptide of 50 kD. AKIII from Bacillus subtilis strain 168 is induced by lysine and repressed by threonine and it is synergistically inhibited by lysine and threonine. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=37.15  E-value=35  Score=21.06  Aligned_cols=32  Identities=13%  Similarity=0.337  Sum_probs=25.6

Q ss_pred             HHHHHhhCCCCCcCCCCCcceeEeeCCCCcEE
Q 048574           22 AYDVLQEYDFPVGILPKGVTRYALNAETGELI   53 (65)
Q Consensus        22 ~yelL~~ygLP~GLLP~gV~~Y~Ld~~tG~F~   53 (65)
                      +-++|++||.|.=.+|.|+.+.++=-++-.++
T Consensus        21 ~L~I~E~~~is~Eh~PSGID~~Siii~~~~~~   52 (76)
T cd04911          21 LLSILEDNGISYEHMPSGIDDISIIIRDNQLT   52 (76)
T ss_pred             HHHHHHHcCCCEeeecCCCccEEEEEEccccc
Confidence            45799999999999999999888765544444


No 12 
>PRK05231 homoserine kinase; Provisional
Probab=36.16  E-value=75  Score=22.16  Aligned_cols=39  Identities=21%  Similarity=0.533  Sum_probs=28.3

Q ss_pred             CCHHHHHhhCCCC--CcC--CCCCc--ceeEeeCCCCcEEEEech
Q 048574           20 PSAYDVLQEYDFP--VGI--LPKGV--TRYALNAETGELIFGTYE   58 (65)
Q Consensus        20 ~t~yelL~~ygLP--~GL--LP~gV--~~Y~Ld~~tG~F~V~~y~   58 (65)
                      ..+-++|+.||+.  .-+  +..|.  +.|.++.++|+|-+++|+
T Consensus        10 ~~l~~~l~~y~~~~~~~~~~l~~G~~n~~y~v~t~~g~~vLK~~~   54 (319)
T PRK05231         10 DELAAFLAPYDLGELLSLKGIAEGIENSNFFLTTTQGEYVLTLFE   54 (319)
T ss_pred             HHHHHHHHhcCCchhhccchhccccccceEEEEeCCCcEEEEEec
Confidence            3467899999982  122  33444  479998888999999885


No 13 
>TIGR00938 thrB_alt homoserine kinase, Neisseria type. Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase.
Probab=35.88  E-value=63  Score=22.68  Aligned_cols=43  Identities=28%  Similarity=0.535  Sum_probs=30.1

Q ss_pred             CCCCCHHHHHhhCCCC--CcCCC--CCc--ceeEeeCCCCcEEEEechh
Q 048574           17 DSEPSAYDVLQEYDFP--VGILP--KGV--TRYALNAETGELIFGTYEQ   59 (65)
Q Consensus        17 ~~~~t~yelL~~ygLP--~GLLP--~gV--~~Y~Ld~~tG~F~V~~y~~   59 (65)
                      .+...+-++|++|++-  .-+-|  .|.  ..|.++.++|+|-++.|..
T Consensus         7 ~~~~~l~~~l~~y~~~~~~~i~~~~~G~~n~~y~v~t~~~~~vLK~~~~   55 (307)
T TIGR00938         7 VSDEEMSSFLDGYDLGELLSLKGIAEGVENSNYLLTTDVGRYILTLYEK   55 (307)
T ss_pred             CCHHHHHHHHHhcCCCCceeccccCCccccceEEEEeCCCcEEEEEecC
Confidence            3346788999999883  22333  343  4799988889999988743


No 14 
>PRK09293 fructose-1,6-bisphosphatase; Provisional
Probab=35.87  E-value=34  Score=25.97  Aligned_cols=18  Identities=28%  Similarity=0.676  Sum_probs=15.8

Q ss_pred             CCcceeEeeCCCCcEEEE
Q 048574           38 KGVTRYALNAETGELIFG   55 (65)
Q Consensus        38 ~gV~~Y~Ld~~tG~F~V~   55 (65)
                      ++|..|+||+++|+|.+.
T Consensus       170 ~gv~~ftld~~~g~f~l~  187 (327)
T PRK09293        170 DGVHGFTLDPSLGEFVLT  187 (327)
T ss_pred             CCEEEEEEeCCCCeEEEe
Confidence            689999999999999754


No 15 
>PF09949 DUF2183:  Uncharacterized conserved protein (DUF2183);  InterPro: IPR019236  This domain, found in various bacterial and fungal proteins, has no known function. 
Probab=35.87  E-value=19  Score=22.94  Aligned_cols=16  Identities=38%  Similarity=0.623  Sum_probs=12.9

Q ss_pred             CCHHHHHhhCCCCCcC
Q 048574           20 PSAYDVLQEYDFPVGI   35 (65)
Q Consensus        20 ~t~yelL~~ygLP~GL   35 (65)
                      +.+.+.|+.+|||.|=
T Consensus        14 ~~l~~Fl~~~~~P~G~   29 (100)
T PF09949_consen   14 PFLRDFLRRNGFPAGP   29 (100)
T ss_pred             HHHHHHHHhcCCCCCc
Confidence            4667788899999984


No 16 
>PF00316 FBPase:  Fructose-1-6-bisphosphatase;  InterPro: IPR000146  This entry represents the fructose-1,6-bisphosphatase (FBPase) class 1 family. FBPase is a critical regulatory enzyme in gluconeogenesis that catalyses the removal of 1-phosphate from fructose 1,6-bis-phosphate to form fructose 6-phosphate [, ]. It is involved in many different metabolic pathways and found in most organisms. FBPase requires metal ions for catalysis (Mg2+ and Mn2+ being preferred) and the enzyme is potently inhibited by Li+. The fold of fructose-1,6-bisphosphatase was noted to be identical to that of inositol-1-phosphatase (IMPase) []. Inositol polyphosphate 1-phosphatase (IPPase), IMPase and FBPase share a sequence motif (Asp-Pro-Ile/Leu-Asp-Gly/Ser-Thr/Ser) which has been shown to bind metal ions and participate in catalysis. This motif is also found in the distantly-related fungal, bacterial and yeast IMPase homologues. It has been suggested that these proteins define an ancient structurally conserved family involved in diverse metabolic pathways, including inositol signalling, gluconeogenesis, sulphate assimilation and possibly quinone metabolism [].  This entry also includes sedoheptulose-1,7-bisphosphatase, which is a member of the FBPase class 1 family.; GO: 0042578 phosphoric ester hydrolase activity, 0005975 carbohydrate metabolic process; PDB: 2GQ1_A 2QVR_A 2Q8M_B 2OX3_A 2OWZ_A 3KC0_C 2WBB_A 1FTA_C 2VT5_F 2Y5L_F ....
Probab=34.97  E-value=28  Score=26.65  Aligned_cols=17  Identities=35%  Similarity=0.804  Sum_probs=15.4

Q ss_pred             CCcceeEeeCCCCcEEE
Q 048574           38 KGVTRYALNAETGELIF   54 (65)
Q Consensus        38 ~gV~~Y~Ld~~tG~F~V   54 (65)
                      .+|..|+||+++|+|.+
T Consensus       169 ~gV~~FtLD~~~g~F~l  185 (324)
T PF00316_consen  169 SGVHGFTLDPSTGEFVL  185 (324)
T ss_dssp             TEEEEEEEETTTTEEEE
T ss_pred             CcEeEEEEeCCCCEEEE
Confidence            47999999999999986


No 17 
>PF11426 Tn7_TnsC_Int:  Tn7 transposition regulator TnsC;  InterPro: IPR021542  TnsC is a molecular switch that regulates transposition and interacts with TnsA which is a component of the transposase. The two proteins interact via the residues 504-555 on TnsC. The TnsA/TnsC interaction is very important in Tn7 transposition []. ; PDB: 1T0F_C.
Probab=34.59  E-value=32  Score=19.85  Aligned_cols=15  Identities=27%  Similarity=0.581  Sum_probs=10.8

Q ss_pred             CCCCCHHHHHhhCCC
Q 048574           17 DSEPSAYDVLQEYDF   31 (65)
Q Consensus        17 ~~~~t~yelL~~ygL   31 (65)
                      .++.++|+.|...|+
T Consensus        22 ~~~~~~y~~Lk~~Gl   36 (48)
T PF11426_consen   22 DNSESVYEALKQNGL   36 (48)
T ss_dssp             -TTS-HHHHHHHTTS
T ss_pred             CchHHHHHHHHHCCe
Confidence            444589999999986


No 18 
>cd04483 hOBFC1_like hOBFC1_like: A subfamily of OB folds similar to that found in human OB fold containing protein 1 (hOBFC1). Members of this group belong to the Replication protein A subunit 2 (RPA2) family of OB folds. RPA is a nuclear ssDNA binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). The OB fold domain of RPA2 has dual roles in ssDNA binding and trimerization.
Probab=34.21  E-value=43  Score=20.69  Aligned_cols=19  Identities=11%  Similarity=0.247  Sum_probs=16.4

Q ss_pred             ceeEeeCCCCcEEEEechh
Q 048574           41 TRYALNAETGELIFGTYEQ   59 (65)
Q Consensus        41 ~~Y~Ld~~tG~F~V~~y~~   59 (65)
                      ..|.||+.||..++..+..
T Consensus        16 ~~~tLdDgTG~Ie~~~W~~   34 (92)
T cd04483          16 YSFGVDDGTGVVNCVCWKN   34 (92)
T ss_pred             EEEEEecCCceEEEEEEcC
Confidence            5799999999999988764


No 19 
>TIGR02503 type_III_SycN type III secretion chaperone SycN. Members of this protein family are part of the machinery of bacterial type III secretion in a number of bacteria that target animal cells. In the well-studied system from Yersinia, a complex of this protein (SycN) and YscB (pfam07329) acts as a chaperone for the export of YopN (PubMed:10094626). YopN then acts to control effector protein secretion, in response to calcium levels, so that secretion occurs only after contact with the targeted eukaryotic cell.
Probab=34.17  E-value=76  Score=21.38  Aligned_cols=40  Identities=10%  Similarity=0.184  Sum_probs=33.0

Q ss_pred             CCHHHHHhhCCCCCcCCCCCcceeEeeCCCCcEEEEechhh
Q 048574           20 PSAYDVLQEYDFPVGILPKGVTRYALNAETGELIFGTYEQQ   60 (65)
Q Consensus        20 ~t~yelL~~ygLP~GLLP~gV~~Y~Ld~~tG~F~V~~y~~~   60 (65)
                      +++.+..+.-|+|..-.|.++..++++. .|++.++=++..
T Consensus         3 ~~l~qF~q~mG~~~~~~~~~~i~l~~e~-~gtL~iE~~~~~   42 (119)
T TIGR02503         3 RALAQFCQDLGLPTPAPLPRLAQLSMEQ-SGRLYVEQHDGT   42 (119)
T ss_pred             HHHHHHHHHcCCCCCCCCCcceEEEecC-CcEEEEEecCCE
Confidence            5678999999999998888899999985 599988765544


No 20 
>PLN02262 fructose-1,6-bisphosphatase
Probab=34.09  E-value=34  Score=26.41  Aligned_cols=18  Identities=33%  Similarity=0.678  Sum_probs=15.9

Q ss_pred             CCcceeEeeCCCCcEEEE
Q 048574           38 KGVTRYALNAETGELIFG   55 (65)
Q Consensus        38 ~gV~~Y~Ld~~tG~F~V~   55 (65)
                      .+|..|+||+++|+|.+.
T Consensus       182 ~gv~~Ftld~~~gef~lt  199 (340)
T PLN02262        182 GGVNGFTLDPSLGEFILT  199 (340)
T ss_pred             CCeeEEEEcCCCCEEEEe
Confidence            689999999999999764


No 21 
>smart00469 WIF Wnt-inhibitory factor-1 like domain. Occurs as extracellular domain in metazoan Ryk receptor tyrosine kinases. C. elegans Ryk is required for cell-cuticle recognition. WIF-1 binds to Wnt and inhibits its activity.
Probab=32.99  E-value=67  Score=22.06  Aligned_cols=35  Identities=14%  Similarity=0.320  Sum_probs=27.7

Q ss_pred             HHH--hhCCCC-CcCCCCCcceeEee-----CCCCcEEEEech
Q 048574           24 DVL--QEYDFP-VGILPKGVTRYALN-----AETGELIFGTYE   58 (65)
Q Consensus        24 elL--~~ygLP-~GLLP~gV~~Y~Ld-----~~tG~F~V~~y~   58 (65)
                      ++|  ..-+.| .|.+|+..+.|++.     ..+|+|+|.++-
T Consensus        71 ~vl~~P~lnI~~~G~VP~~~~~f~V~l~CsG~~sa~~~V~l~l  113 (136)
T smart00469       71 EVLPRPIVNISLLGTVPHTLQVFQVELKCSGKRDAEVEVTVIV  113 (136)
T ss_pred             HHcCCCcccccccccCCCCcEEEEEEEEecCCcceEEEEEEEE
Confidence            566  566788 89999999999884     345899998763


No 22 
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional
Probab=32.98  E-value=74  Score=18.97  Aligned_cols=16  Identities=25%  Similarity=0.391  Sum_probs=13.5

Q ss_pred             CCCCHHHHHhhCCCCC
Q 048574           18 SEPSAYDVLQEYDFPV   33 (65)
Q Consensus        18 ~~~t~yelL~~ygLP~   33 (65)
                      ...|+-|.|++.|++.
T Consensus        18 ~~~tlL~a~~~~gi~~   33 (84)
T PRK10713         18 EHPSLLAALESHNVAV   33 (84)
T ss_pred             CCCcHHHHHHHcCCCC
Confidence            3479999999999974


No 23 
>cd00354 FBPase Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate  into fructose-6-phosphate and is critical in gluconeogenesis pathway. The alignment model also includes chloroplastic FBPases and sedoheptulose-1,7-biphosphatases that play a role in pentose phosphate pathway (Calvin cycle).
Probab=32.72  E-value=36  Score=25.69  Aligned_cols=18  Identities=33%  Similarity=0.711  Sum_probs=16.1

Q ss_pred             CCcceeEeeCCCCcEEEE
Q 048574           38 KGVTRYALNAETGELIFG   55 (65)
Q Consensus        38 ~gV~~Y~Ld~~tG~F~V~   55 (65)
                      .+|..|+||+++|+|.+.
T Consensus       163 ~gv~~ftld~~~g~f~lt  180 (315)
T cd00354         163 QGVHGFTLDPSLGEFILT  180 (315)
T ss_pred             CceEEEEEcCCCCeEEEe
Confidence            789999999989999764


No 24 
>PLN02628 fructose-1,6-bisphosphatase family protein
Probab=32.56  E-value=38  Score=26.42  Aligned_cols=18  Identities=28%  Similarity=0.656  Sum_probs=15.8

Q ss_pred             CCcceeEeeCCCCcEEEE
Q 048574           38 KGVTRYALNAETGELIFG   55 (65)
Q Consensus        38 ~gV~~Y~Ld~~tG~F~V~   55 (65)
                      .+|..|+||+++|+|.+.
T Consensus       192 ~gv~~Ftld~~~geF~lt  209 (351)
T PLN02628        192 SGTHGFTLDHSTGEFVLT  209 (351)
T ss_pred             CCeeEEEEeCCCCEEEEe
Confidence            689999999999999753


No 25 
>PF14567 SUKH_5:  SMI1-KNR4 cell-wall; PDB: 2PAG_A.
Probab=32.42  E-value=18  Score=24.44  Aligned_cols=30  Identities=23%  Similarity=0.462  Sum_probs=18.1

Q ss_pred             CHHHHHhhCCCCCcCCC---CCcceeEeeCCCCc
Q 048574           21 SAYDVLQEYDFPVGILP---KGVTRYALNAETGE   51 (65)
Q Consensus        21 t~yelL~~ygLP~GLLP---~gV~~Y~Ld~~tG~   51 (65)
                      .+..-+++.|+|+-++|   .+=.-|-|++ +|+
T Consensus        73 e~~~~ar~~glP~~~ipice~~~~yYcl~~-~g~  105 (132)
T PF14567_consen   73 EVTADARSIGLPRELIPICEDGGDYYCLDQ-EGE  105 (132)
T ss_dssp             HHHHHHHHHT--TTSEEEEEETTEEEEE-T-TS-
T ss_pred             HHHHHHHHcCCChhheeEEecCCcEEEEeC-CCe
Confidence            34445678999999999   4545677885 476


No 26 
>cd01781 AF6_RA_repeat2 Ubiquitin domain of AT-6, second repeat. The AF-6 protein (also known as afadin and canoe) is a multidomain cell junction protein that contains two N-terminal Ras-associating (RA) domains in addition to FHA (forkhead-associated), DIL (class V myosin homology region), and PDZ domains and a proline-rich region. AF6 acts downstream of the Egfr (Epidermal Growth Factor-receptor)/Ras signalling pathway and provides a link from Egfr to cytoskeletal elements.
Probab=31.09  E-value=30  Score=22.69  Aligned_cols=25  Identities=16%  Similarity=0.230  Sum_probs=17.6

Q ss_pred             CCHHHHHhhCCCCCcCCCCCcceeEeeCC
Q 048574           20 PSAYDVLQEYDFPVGILPKGVTRYALNAE   48 (65)
Q Consensus        20 ~t~yelL~~ygLP~GLLP~gV~~Y~Ld~~   48 (65)
                      .=+-|.|++|||-.    ....+|.|-+-
T Consensus        30 ~vV~eALeKygL~~----e~p~~Y~LveV   54 (100)
T cd01781          30 RIVGEALEKYGLEK----SDPDDYCLVEV   54 (100)
T ss_pred             HHHHHHHHHhCCCc----cCccceEEEEE
Confidence            34578899999853    45778887653


No 27 
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp. PCC 7335 (EDX86601). Uncharacterized aldehyde dehydrogenase of Synechococcus sp. PCC 7335 (locus EDX86601) and other similar sequences, are present in this CD.
Probab=31.05  E-value=32  Score=25.83  Aligned_cols=16  Identities=19%  Similarity=0.372  Sum_probs=13.6

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       161 ~l~~~l~~aGlP~g~~  176 (452)
T cd07102         161 RFAAAFAEAGLPEGVF  176 (452)
T ss_pred             HHHHHHHhcCCCcCcE
Confidence            4689999999999974


No 28 
>cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains. This CD includes the first of two ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains. AK is the first enzyme in the aspartate metabolic pathway, catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP, and in fungi, is responsible for the production of threonine, isoleucine and methionine. S. cerevisiae has a single AK, which is regulated by feedback, allosteric inhibition by L-threonine. Recent studies shown that the allosteric transition triggered by binding of threonine to AK involves a large change in the conformation of the native hexameric enzyme that is converted to an inactive one of different shape and substantially smaller hydro
Probab=30.76  E-value=35  Score=20.09  Aligned_cols=32  Identities=9%  Similarity=0.346  Sum_probs=23.3

Q ss_pred             CCHHHHHhhCCCCCcCCCCCcceeEeeCCCCc
Q 048574           20 PSAYDVLQEYDFPVGILPKGVTRYALNAETGE   51 (65)
Q Consensus        20 ~t~yelL~~ygLP~GLLP~gV~~Y~Ld~~tG~   51 (65)
                      ..+.+.|.++|.++-++|.+..+++|--....
T Consensus        19 ~~If~~la~~~I~vd~I~~s~~~isftv~~~~   50 (73)
T cd04934          19 ARIFAILDKYRLSVDLISTSEVHVSMALHMEN   50 (73)
T ss_pred             HHHHHHHHHcCCcEEEEEeCCCEEEEEEehhh
Confidence            36778999999999999976665555433333


No 29 
>cd04890 ACT_AK-like_1 ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). This CD includes the first of two ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). AK catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP, and is the first enzyme in the pathway of the biosynthesis of the aspartate family of amino acids, lysine, threonine, methionine, and isoleucine. This CD, includes the first ACT domain of the Escherichia coli (EC) isoenzyme, AKIII (LysC) and the Arabidopsis isoenzyme, asparate kinase 1, both enzymes monofunctional and involved in lysine synthesis, as well as the the first ACT domain of Bacillus subtilis (BS) isoenzyme, AKIII (YclM), and of the Saccharomyces cerevisiae AK (Hom3). Also included are the first ACT domains of the Methylomicrobium alcaliphilum AK, the first enzyme of the ectoine biosynthetic pathway. Members of this CD bel
Probab=30.44  E-value=40  Score=18.16  Aligned_cols=25  Identities=12%  Similarity=0.409  Sum_probs=19.5

Q ss_pred             CCHHHHHhhCCCCCcCCCCCcceeE
Q 048574           20 PSAYDVLQEYDFPVGILPKGVTRYA   44 (65)
Q Consensus        20 ~t~yelL~~ygLP~GLLP~gV~~Y~   44 (65)
                      ..+.+.|+++|.+.-++|.+..+.+
T Consensus        18 ~~if~~l~~~~i~v~~i~t~~~~is   42 (62)
T cd04890          18 RKIFEILEKHGISVDLIPTSENSVT   42 (62)
T ss_pred             HHHHHHHHHcCCeEEEEecCCCEEE
Confidence            3577899999999999987554433


No 30 
>PRK08364 sulfur carrier protein ThiS; Provisional
Probab=29.93  E-value=72  Score=18.50  Aligned_cols=17  Identities=18%  Similarity=0.257  Sum_probs=13.9

Q ss_pred             CCCCCHHHHHhhCCCCC
Q 048574           17 DSEPSAYDVLQEYDFPV   33 (65)
Q Consensus        17 ~~~~t~yelL~~ygLP~   33 (65)
                      .+..|+.|+|++.|+|.
T Consensus        21 ~~~~tv~~ll~~l~~~~   37 (70)
T PRK08364         21 RKGMKVADILRAVGFNT   37 (70)
T ss_pred             CCCCcHHHHHHHcCCCC
Confidence            44569999999999874


No 31 
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like. Aldehyde dehydrogenase ALDH21A1 (gene name RNP123) was first described in the moss Tortula ruralis and is believed to play an important role in the detoxification of aldehydes generated in response to desiccation- and salinity-stress, and ALDH21A1 expression represents a unique stress tolerance mechanism. So far, of plants, only the bryophyte sequence has been observed, but similar protein sequences from bacteria and archaea are also present in this CD.
Probab=29.64  E-value=35  Score=25.68  Aligned_cols=16  Identities=31%  Similarity=0.426  Sum_probs=13.6

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       168 ~l~~~l~~ag~P~g~v  183 (452)
T cd07147         168 ILGEVLAETGLPKGAF  183 (452)
T ss_pred             HHHHHHHHcCCCcCcE
Confidence            3689999999999965


No 32 
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1. NAD+-dependent, 4-trimethylaminobutyraldehyde dehydrogenase (TMABADH, EC=1.2.1.47), also known as aldehyde dehydrogenase family 9 member A1 (ALDH9A1) in humans, is a cytosolic tetramer which catalyzes the oxidation of gamma-aminobutyraldehyde involved in 4-aminobutyric acid (GABA) biosynthesis  and also oxidizes betaine aldehyde (gamma-trimethylaminobutyraldehyde) which is involved in carnitine biosynthesis.
Probab=29.60  E-value=34  Score=25.86  Aligned_cols=16  Identities=25%  Similarity=0.505  Sum_probs=13.9

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       161 ~l~~~~~~aGlP~g~~  176 (457)
T cd07090         161 LLAEILTEAGLPDGVF  176 (457)
T ss_pred             HHHHHHHHcCCCcccE
Confidence            4689999999999975


No 33 
>PLN02542 fructose-1,6-bisphosphatase
Probab=29.57  E-value=43  Score=26.76  Aligned_cols=18  Identities=28%  Similarity=0.597  Sum_probs=15.9

Q ss_pred             CCcceeEeeCCCCcEEEE
Q 048574           38 KGVTRYALNAETGELIFG   55 (65)
Q Consensus        38 ~gV~~Y~Ld~~tG~F~V~   55 (65)
                      .||..|+||+++|+|.+.
T Consensus       259 ~GV~~FtLDp~~geFvLt  276 (412)
T PLN02542        259 TGVFSFTLDPMYGEFVLT  276 (412)
T ss_pred             CCEEEEEEcCCCCeEEEe
Confidence            699999999999999753


No 34 
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins. ALDH subfamily which includes the NAD(P)+-dependent, benzaldehyde dehydrogenase II (XylC, BenzADH, EC=1.2.1.28)  involved in the oxidation of benzyl alcohol to benzoate; p-hydroxybenzaldehyde dehydrogenase (PchA, HBenzADH) which catalyzes the oxidation of p-hydroxybenzaldehyde to p-hydroxybenzoic acid; vanillin dehydrogenase (Vdh, VaniDH) involved in the metabolism of ferulic acid as seen in Pseudomonas putida KT2440; and other related sequences.
Probab=29.56  E-value=34  Score=25.37  Aligned_cols=15  Identities=27%  Similarity=0.658  Sum_probs=13.2

Q ss_pred             HHHHHhhCCCCCcCC
Q 048574           22 AYDVLQEYDFPVGIL   36 (65)
Q Consensus        22 ~yelL~~ygLP~GLL   36 (65)
                      +.++|++.|||.|++
T Consensus       145 l~~~l~~aGlP~gvv  159 (431)
T cd07104         145 IAEIFEEAGLPKGVL  159 (431)
T ss_pred             HHHHHHHcCCCcccE
Confidence            689999999999865


No 35 
>TIGR02689 ars_reduc_gluta arsenate reductase, glutathione/glutaredoxin type. Members of this protein family represent a novel form of arsenate reductase, using glutathione and glutaredoxin rather than thioredoxin for reducing equivalents as do some homologous arsenate reductases. An example of this type is Synechocystis sp. strain PCC 6803 slr0946, and of latter type (excluded from this model) is Staphylococcus aureus plasmid pI258 ArsC. Both are among the subset of arsenate reductases that belong the the low-molecular-weight protein-tyrosine phosphatase superfamily.
Probab=28.92  E-value=40  Score=21.27  Aligned_cols=38  Identities=16%  Similarity=0.309  Sum_probs=28.8

Q ss_pred             CCCCCHHHHHhhCCCC-CcCCCCCcceeEeeCCCCcEEEEe
Q 048574           17 DSEPSAYDVLQEYDFP-VGILPKGVTRYALNAETGELIFGT   56 (65)
Q Consensus        17 ~~~~t~yelL~~ygLP-~GLLP~gV~~Y~Ld~~tG~F~V~~   56 (65)
                      ...+.+-++|+++|++ .|.-|+.++.+.+..  -.+-|.+
T Consensus        40 ~~~p~a~~~l~e~Gid~~~~~s~~l~~~~~~~--~D~iitm   78 (126)
T TIGR02689        40 RVHPTAIEVMSEIGIDISGQTSKPLENFHPED--YDVVISL   78 (126)
T ss_pred             CCCHHHHHHHHHhCCCcccCccccCChhHhcC--CCEEEEe
Confidence            4567889999999997 588999999887653  3455544


No 36 
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism]
Probab=28.86  E-value=26  Score=24.48  Aligned_cols=36  Identities=8%  Similarity=0.336  Sum_probs=29.5

Q ss_pred             CCCCCCHHHHHhhCCCCCcCCCCC-------cceeEeeCCCCc
Q 048574           16 ADSEPSAYDVLQEYDFPVGILPKG-------VTRYALNAETGE   51 (65)
Q Consensus        16 ~~~~~t~yelL~~ygLP~GLLP~g-------V~~Y~Ld~~tG~   51 (65)
                      ...-+-+.++|+.|+++.+|+|++       +..|.+.+.+|.
T Consensus         8 ~~Di~~I~~Li~~~~~~gil~~rs~~~le~~i~dF~i~E~~g~   50 (153)
T COG1246           8 ISDIPAILELIRPLELQGILLRRSREQLEEEIDDFTIIERDGK   50 (153)
T ss_pred             ccchHHHHHHHHHHhhccccchhhHHHHHHHHhhheeeeeCCc
Confidence            355678999999999999999975       468888887776


No 37 
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism]
Probab=28.85  E-value=53  Score=19.73  Aligned_cols=15  Identities=13%  Similarity=0.226  Sum_probs=13.5

Q ss_pred             CCCHHHHHhhCCCCC
Q 048574           19 EPSAYDVLQEYDFPV   33 (65)
Q Consensus        19 ~~t~yelL~~ygLP~   33 (65)
                      ..|+.|+|++.||+.
T Consensus        17 ~~tv~dLL~~l~~~~   31 (68)
T COG2104          17 GTTVADLLAQLGLNP   31 (68)
T ss_pred             CCcHHHHHHHhCCCC
Confidence            379999999999996


No 38 
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like. Succinate-semialdehyde dehydrogenase 2 (SSADH2) and similar proteins are in this CD. SSADH1 (GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde to succinate.  SSADH activity in Mycobacterium tuberculosis is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731), however ,the Vmax of GabD1 was shown to be much higher than that of GabD2, and GabD2 (SSADH2) is likely to serve physiologically as a dehydrogenase for a different aldehyde(s).
Probab=27.74  E-value=38  Score=25.62  Aligned_cols=16  Identities=25%  Similarity=0.333  Sum_probs=13.7

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       163 ~l~~~~~~aglP~gv~  178 (454)
T cd07101         163 WAVELLIEAGLPRDLW  178 (454)
T ss_pred             HHHHHHHHcCcCCCcE
Confidence            3589999999999976


No 39 
>PF03975 CheD:  CheD chemotactic sensory transduction;  InterPro: IPR005659 CheD deamidates glutamine residues to glutamate on methyl-accepting chemotaxis receptors (MCPs). CheD-mediated MCP deamidation is required for productive communication of the conformational signals of the chemoreceptors to the cheA kinase []. CheC is a CheY-P phosphatase (CheY controls flagellar rotation and is activated by phosphorylation). The activity of CheC is enhanced by its interaction with CheD, forming a CheC-CheD heterodimer. It is suggested that CheC exerts its effect on MCP methylation in Bacillus subtilis by controlling the binding of CheD to the MCPs [].; GO: 0050568 protein-glutamine glutaminase activity, 0006935 chemotaxis; PDB: 2F9Z_D.
Probab=27.44  E-value=85  Score=19.90  Aligned_cols=40  Identities=20%  Similarity=0.357  Sum_probs=23.0

Q ss_pred             CCHHHHHhhCCCCC------cCCCCCcceeEeeCCCCcEEEEechhhhh
Q 048574           20 PSAYDVLQEYDFPV------GILPKGVTRYALNAETGELIFGTYEQQLQ   62 (65)
Q Consensus        20 ~t~yelL~~ygLP~------GLLP~gV~~Y~Ld~~tG~F~V~~y~~~~~   62 (65)
                      ..+-++|+++|+|+      |-.+..   =.||..||+..|...+...|
T Consensus        67 ~~a~~~L~~~gi~I~a~dvGG~~~R~---v~f~~~tG~v~vk~~~~~~~  112 (114)
T PF03975_consen   67 EAARELLAEEGIPIVAEDVGGNFGRK---VRFDPATGEVWVKRIGREEK  112 (114)
T ss_dssp             HHHHHHHHHTT--EEEEEE-SSS-EE---EEEETTTTEEEEE-------
T ss_pred             HHHHHHHHHCCCcEEEeeCCCCCCcE---EEEEcCCCEEEEEECCCccc
Confidence            35789999999995      444443   45788899999988776654


No 40 
>PF03020 LEM:  LEM domain;  InterPro: IPR003887 The LEM domain is found in nuclear membrane-associated proteins, including lamino-associated polypeptide 2 and emerin []. Defects in the emerin gene are a cause of Emery-Dreifuss muscular dystrophy, an X-linked disorder characterised by early contractures, muscle wasting, weakness and cardiomyopathy.; GO: 0005635 nuclear envelope; PDB: 2ODG_C 2ODC_I 1JEI_A 1H9F_A 1GJJ_A.
Probab=27.38  E-value=16  Score=20.69  Aligned_cols=20  Identities=30%  Similarity=0.403  Sum_probs=11.6

Q ss_pred             CCCCCHHHHHhhCCCCCcCC
Q 048574           17 DSEPSAYDVLQEYDFPVGIL   36 (65)
Q Consensus        17 ~~~~t~yelL~~ygLP~GLL   36 (65)
                      -+...+.+.|+++|++.|=+
T Consensus         6 LSd~ELr~~L~~~G~~~GPI   25 (43)
T PF03020_consen    6 LSDEELREELREYGEPPGPI   25 (43)
T ss_dssp             C-CCCCHHCCCCCT-S----
T ss_pred             cCHHHHHHHHHHcCCCCCCC
Confidence            44557889999999999844


No 41 
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins. ALDH subfamily which includes the NAD+-dependent retinal dehydrogenase 1 (RALDH 1, ALDH1, EC=1.2.1.36), also known as aldehyde dehydrogenase family 1 member A1 (ALDH1A1), in humans, a homotetrameric, cytosolic enzyme that catalyzes the oxidation of retinaldehyde to retinoic acid. Human ALDH1B1 and ALDH2 are also in this cluster; both are mitochrondrial homotetramers which play important roles in acetaldehyde oxidation; ALDH1B1 in response to UV light exposure and ALDH2 during ethanol metabolism. 10-formyltetrahydrofolate dehydrogenase (FTHFDH, EC=1.5.1.6), also known as aldehyde dehydrogenase family 1 member L1 (ALDH1L1), in humans, a multi-domain homotetramer with an N-terminal formyl transferase domain and a C-terminal ALDH domain. FTHFDH catalyzes an NADP+-dependent dehydrogenase reaction resulting in the co
Probab=27.36  E-value=39  Score=25.73  Aligned_cols=16  Identities=25%  Similarity=0.611  Sum_probs=13.6

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       186 ~l~~~~~~aglP~g~~  201 (476)
T cd07091         186 YLAELIKEAGFPPGVV  201 (476)
T ss_pred             HHHHHHHHcCcCCCcE
Confidence            4689999999999965


No 42 
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like. Uncharacterized aldehyde dehydrogenase of Candidatus kuenenia AldH (locus CAJ73105) and similar sequences with similarity to alpha-aminoadipic semialdehyde dehydrogenase (AASADH, human ALDH7A1, EC=1.2.1.31), Arabidopsis ALDH7B4, and Streptomyces clavuligerus delta-1-piperideine-6-carboxylate dehydrogenase (P6CDH) are included in this CD.
Probab=27.27  E-value=40  Score=25.64  Aligned_cols=16  Identities=19%  Similarity=0.519  Sum_probs=13.5

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       180 ~l~~~l~~aGlP~gvv  195 (478)
T cd07131         180 KLVELFAEAGLPPGVV  195 (478)
T ss_pred             HHHHHHHhcCcCCCcE
Confidence            3579999999999875


No 43 
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.
Probab=27.17  E-value=40  Score=25.69  Aligned_cols=16  Identities=19%  Similarity=0.764  Sum_probs=13.7

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       179 ~l~~~~~~aGlP~gv~  194 (482)
T cd07119         179 ALFELIEEAGLPAGVV  194 (482)
T ss_pred             HHHHHHHHcCCCcCcE
Confidence            4689999999999975


No 44 
>PF14974 DUF4511:  Domain of unknown function (DUF4511)
Probab=27.00  E-value=40  Score=22.34  Aligned_cols=11  Identities=36%  Similarity=0.969  Sum_probs=9.4

Q ss_pred             HHHHhhCCCCC
Q 048574           23 YDVLQEYDFPV   33 (65)
Q Consensus        23 yelL~~ygLP~   33 (65)
                      -++.++||||.
T Consensus        54 ~~VIk~yGF~~   64 (105)
T PF14974_consen   54 MEVIKKYGFPE   64 (105)
T ss_pred             HHHHHHcCCCC
Confidence            47899999996


No 45 
>cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32). RPA2 is a subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B; RPA2 DBD-D is a weak ssDNA-binding domain. RPA2 DBD-D is also involved in trimerization. The ssDNA binding mechanism is believed to be multistep and to involve conformational change. N-terminal to human RPA2 DBD-D is a domain containing all the known phosphorylation sites of RPA. Human RPA2 is phosphorylated in a cell cycle dependent manner in response to DNA dam
Probab=26.71  E-value=80  Score=18.46  Aligned_cols=21  Identities=14%  Similarity=0.297  Sum_probs=17.2

Q ss_pred             CcceeEeeCCCCcEEEEechh
Q 048574           39 GVTRYALNAETGELIFGTYEQ   59 (65)
Q Consensus        39 gV~~Y~Ld~~tG~F~V~~y~~   59 (65)
                      .-..|+|++.||+.++..+..
T Consensus        16 ~~~~~tL~D~TG~I~~~~W~~   36 (95)
T cd04478          16 TNITYTIDDGTGTIEVRQWLD   36 (95)
T ss_pred             cEEEEEEECCCCcEEEEEeCC
Confidence            446899999999999888753


No 46 
>PF02772 S-AdoMet_synt_M:  S-adenosylmethionine synthetase, central domain;  InterPro: IPR022629  The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold. This entry represents the central domain and is found in association with PF00438 from PFAM and PF02773 from PFAM. S-adenosylmethionine synthetase (MAT, 2.5.1.6 from EC) is the enzyme that catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP []. AdoMet is an important methyl donor for transmethylation and is also the propylamino donor in polyamine biosynthesis. In bacteria there is a single isoform of AdoMet synthetase (gene metK), there are two in budding yeast (genes SAM1 and SAM2) and in mammals while in plants there is generally a multigene family. The sequence of AdoMet synthetase is highly conserved throughout isozymes and species. The active sites of both the Escherichia coli and rat liver MAT reside between two subunits, with contributions from side chains of residues from both subunits, resulting in a dimer as the minimal catalytic entity. The side chains that contribute to the ligand binding sites are conserved between the two proteins. In the structures of complexes with the E. coli enzyme, the phosphate groups have the same positions in the (PPi plus Pi) complex and the (ADP plus Pi) complex, and are located at the bottom of a deep cavity with the adenosyl group nearer the entrance []; GO: 0004478 methionine adenosyltransferase activity; PDB: 3S82_B 2OBV_A 3RV2_A 1FUG_A 1RG9_D 1XRA_A 1P7L_C 1XRB_A 1MXA_A 1MXB_A ....
Probab=26.27  E-value=32  Score=22.99  Aligned_cols=23  Identities=22%  Similarity=0.355  Sum_probs=14.4

Q ss_pred             hCCCCCcCCCCCcceeEeeCCCCcE
Q 048574           28 EYDFPVGILPKGVTRYALNAETGEL   52 (65)
Q Consensus        28 ~ygLP~GLLP~gV~~Y~Ld~~tG~F   52 (65)
                      +.=+|..++.+. +.|-+|++ |+|
T Consensus        98 ~~v~~~~~~~~~-t~~~INPt-GrF  120 (120)
T PF02772_consen   98 KPVIPEYLLDED-TKILINPT-GRF  120 (120)
T ss_dssp             HHHSHGGG-BTT--EEEESTT-S--
T ss_pred             HHhcccccCCCC-cEEEECCC-CCC
Confidence            345677777777 99999985 998


No 47 
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like. NAD(P)+-dependent Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c, ALD5, EC=1.2.1.5) and other similar sequences, are present in this CD.
Probab=25.93  E-value=42  Score=25.69  Aligned_cols=16  Identities=25%  Similarity=0.557  Sum_probs=13.7

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       189 ~l~~~~~~aglP~gv~  204 (484)
T cd07144         189 YFANLVKEAGFPPGVV  204 (484)
T ss_pred             HHHHHHHHhCcCCCcE
Confidence            3689999999999876


No 48 
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like. Present in this CD are the Arabidopsis betaine aldehyde dehydrogenase (BADH) 1 (chloroplast) and 2 (mitochondria), also known as, aldehyde dehydrogenase family 10 member A8 and aldehyde dehydrogenase family 10 member A9, respectively, and are putative dehydration- and salt-inducible BADHs (EC 1.2.1.8) that catalyze the oxidation of betaine aldehyde to the compatible solute glycine betaine.
Probab=25.64  E-value=44  Score=25.20  Aligned_cols=16  Identities=25%  Similarity=0.505  Sum_probs=13.3

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       165 ~l~~~~~~aGlP~gvv  180 (456)
T cd07110         165 ELAEIAAEAGLPPGVL  180 (456)
T ss_pred             HHHHHHHHcCCCCCcE
Confidence            4678999999998865


No 49 
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]
Probab=25.64  E-value=52  Score=25.93  Aligned_cols=17  Identities=35%  Similarity=0.749  Sum_probs=14.8

Q ss_pred             CcceeEeeCCCCcEEEE
Q 048574           39 GVTRYALNAETGELIFG   55 (65)
Q Consensus        39 gV~~Y~Ld~~tG~F~V~   55 (65)
                      +|.+|.+|+++|+|+.-
T Consensus        65 gvaay~iD~~~G~Lt~l   81 (346)
T COG2706          65 GVAAYRIDPDDGRLTFL   81 (346)
T ss_pred             cEEEEEEcCCCCeEEEe
Confidence            78999999989999863


No 50 
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like. NADP+-dependent, p-hydroxybenzaldehyde dehydrogenase (PchA, HBenzADH) which catalyzes oxidation of p-hydroxybenzaldehyde to p-hydroxybenzoic acid and other related sequences are included in this CD.
Probab=25.59  E-value=45  Score=25.37  Aligned_cols=15  Identities=27%  Similarity=0.600  Sum_probs=13.1

Q ss_pred             HHHHHhhCCCCCcCC
Q 048574           22 AYDVLQEYDFPVGIL   36 (65)
Q Consensus        22 ~yelL~~ygLP~GLL   36 (65)
                      +.++|++.|||.|++
T Consensus       177 l~~~l~~aG~P~gvv  191 (465)
T cd07151         177 LAKIFEEAGLPKGVL  191 (465)
T ss_pred             HHHHHHHcCcCccce
Confidence            588999999998876


No 51 
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like. In humans, the  aldehyde dehydrogenase family 8 member A1 (ALDH8A1) protein functions to convert 9-cis-retinal to 9-cis-retinoic acid and has a preference for NAD+. Also included in this CD is the 2-hydroxymuconic semialdehyde dehydrogenase (HMSADH) which catalyzes the conversion of 2-hydroxymuconic semialdehyde to 4-oxalocrotonate, a step in the meta cleavage pathway of aromatic hydrocarbons in bacteria. Such HMSADHs seen here are: XylG of the TOL plasmid pWW0 of Pseudomonas putida, TomC  of Burkholderia cepacia G4, and AphC of Comamonas testosterone.
Probab=25.37  E-value=48  Score=24.91  Aligned_cols=17  Identities=18%  Similarity=0.362  Sum_probs=14.2

Q ss_pred             CHHHHHhhCCCCCcCCC
Q 048574           21 SAYDVLQEYDFPVGILP   37 (65)
Q Consensus        21 t~yelL~~ygLP~GLLP   37 (65)
                      -+.++|++.|||.|++-
T Consensus       162 ~l~~~l~~aglP~g~v~  178 (455)
T cd07093         162 LLAELANEAGLPPGVVN  178 (455)
T ss_pred             HHHHHHHhcCCCccceE
Confidence            46899999999988764


No 52 
>PRK06437 hypothetical protein; Provisional
Probab=25.32  E-value=74  Score=18.49  Aligned_cols=17  Identities=18%  Similarity=0.399  Sum_probs=13.8

Q ss_pred             CCCCCHHHHHhhCCCCC
Q 048574           17 DSEPSAYDVLQEYDFPV   33 (65)
Q Consensus        17 ~~~~t~yelL~~ygLP~   33 (65)
                      ....|+.|+|++.|+|.
T Consensus        18 ~~~~tv~dLL~~Lgi~~   34 (67)
T PRK06437         18 DHELTVNDIIKDLGLDE   34 (67)
T ss_pred             CCCCcHHHHHHHcCCCC
Confidence            34469999999999973


No 53 
>PLN02766 coniferyl-aldehyde dehydrogenase
Probab=25.28  E-value=44  Score=26.02  Aligned_cols=16  Identities=13%  Similarity=0.162  Sum_probs=13.5

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       203 ~l~~~~~~aGlP~gvv  218 (501)
T PLN02766        203 FYAHLAKLAGVPDGVI  218 (501)
T ss_pred             HHHHHHHhcCCCcCcE
Confidence            3578999999999876


No 54 
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional
Probab=25.19  E-value=44  Score=25.64  Aligned_cols=15  Identities=20%  Similarity=0.494  Sum_probs=12.9

Q ss_pred             HHHHHhhCCCCCcCC
Q 048574           22 AYDVLQEYDFPVGIL   36 (65)
Q Consensus        22 ~yelL~~ygLP~GLL   36 (65)
                      +.+++++.|||.|++
T Consensus       172 l~~~~~~aGlP~gv~  186 (462)
T PRK13968        172 IAQVFKDAGIPQGVY  186 (462)
T ss_pred             HHHHHHHcCcCcCcE
Confidence            578899999999974


No 55 
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like. The 6-oxolauric acid dehydrogenase (CddD) from Rhodococcus ruber SC1 which converts 6-oxolauric acid to dodecanedioic acid, and the aldehyde dehydrogenase (locus SSP0762) from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 and other similar sequences, are included in this CD.
Probab=25.16  E-value=46  Score=25.25  Aligned_cols=16  Identities=25%  Similarity=0.592  Sum_probs=13.5

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       175 ~l~~~~~~aGlP~g~v  190 (466)
T cd07138         175 ILAEILDEAGLPAGVF  190 (466)
T ss_pred             HHHHHHHHcCCCCCcE
Confidence            4589999999999865


No 56 
>PF03990 DUF348:  Domain of unknown function (DUF348)     ;  InterPro: IPR007137 This domain normally occurs as tandem repeats; however it is found as a single copy in the Saccharomyces cerevisiae (Baker's yeast) DNA-binding nuclear protein YCR593 (P25357 from SWISSPROT).
Probab=25.14  E-value=76  Score=16.93  Aligned_cols=18  Identities=22%  Similarity=0.427  Sum_probs=14.8

Q ss_pred             CCCCCHHHHHhhCCCCCc
Q 048574           17 DSEPSAYDVLQEYDFPVG   34 (65)
Q Consensus        17 ~~~~t~yelL~~ygLP~G   34 (65)
                      ....|+-|+|++.|...|
T Consensus        15 T~a~tV~~~L~~~gI~l~   32 (43)
T PF03990_consen   15 TTASTVGDALKELGITLG   32 (43)
T ss_pred             eCCCCHHHHHHhCCCCCC
Confidence            456799999999998864


No 57 
>PRK13488 chemoreceptor glutamine deamidase CheD; Provisional
Probab=24.84  E-value=1.7e+02  Score=19.97  Aligned_cols=37  Identities=19%  Similarity=0.283  Sum_probs=28.2

Q ss_pred             CCHHHHHhhCCCCC------cCCCCCcceeEeeCCCCcEEEEechh
Q 048574           20 PSAYDVLQEYDFPV------GILPKGVTRYALNAETGELIFGTYEQ   59 (65)
Q Consensus        20 ~t~yelL~~ygLP~------GLLP~gV~~Y~Ld~~tG~F~V~~y~~   59 (65)
                      ..+-++|+++|+|.      |--+   +.=.|+.+||+..|+..+.
T Consensus       110 ~~a~~~L~~~gi~i~a~dvGG~~g---R~i~f~~~tG~v~vk~~~~  152 (157)
T PRK13488        110 ESAKETLKKLGIRIVAEDVGGDYG---RTVKFDLKTGKVIVRKANG  152 (157)
T ss_pred             HHHHHHHHHCCCcEEEEEcCCCCC---cEEEEECCCCEEEEEEcCC
Confidence            46789999999996      4443   3446888899999987663


No 58 
>PRK10090 aldehyde dehydrogenase A; Provisional
Probab=24.81  E-value=46  Score=25.30  Aligned_cols=16  Identities=19%  Similarity=0.532  Sum_probs=13.7

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       116 ~l~~~~~~aglP~gv~  131 (409)
T PRK10090        116 AFAKIVDEIGLPKGVF  131 (409)
T ss_pred             HHHHHHHHcCCCcccE
Confidence            4689999999999876


No 59 
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like. Lactaldehyde dehydrogenase from Escherichia coli (AldA, LactADH, EC=1.2.1.22), an NAD(+)-dependent enzyme involved in the metabolism of L-fucose and L-rhamnose, and other similar sequences are present in this CD.
Probab=24.80  E-value=47  Score=25.11  Aligned_cols=16  Identities=25%  Similarity=0.580  Sum_probs=13.5

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       178 ~l~~~~~~aglP~gvv  193 (468)
T cd07088         178 EFAELVDEAGLPAGVL  193 (468)
T ss_pred             HHHHHHHHcCcCccce
Confidence            4689999999998875


No 60 
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase. This model represents the dehydrogenase responsible for the conversion of 5-carboxymethyl-2-hydroxymuconate semialdehyde to 5-carboxymethyl-2-hydroxymuconate (a tricarboxylic acid). This is the step in the degradation of 4-hydroxyphenylacetic acid via homoprotocatechuate following the oxidative opening of the aromatic ring.
Probab=24.59  E-value=43  Score=25.63  Aligned_cols=16  Identities=19%  Similarity=0.468  Sum_probs=13.3

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       180 ~l~~~~~~aGlP~gvv  195 (488)
T TIGR02299       180 RLAEIAKEAGLPDGVF  195 (488)
T ss_pred             HHHHHHHHcCcChhhe
Confidence            3589999999998875


No 61 
>PF01336 tRNA_anti-codon:  OB-fold nucleic acid binding domain;  InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands. The OB-fold is a five/six-stranded closed beta-barrel formed by 70-80 amino acid residues. The strands are connected by loops of varying length which form the functional appendages of the protein. The majority of OB-fold proteins use the same face for ligand binding or as an active site. Different OB-fold proteins use this 'fold-related binding face' to, variously, bind oligosaccharides, oligonucleotides, proteins, metal ions and catalytic substrates.  This entry contains OB-fold domains that bind to nucleic acids []. It includes the anti-codon binding domain of lysyl, aspartyl, and asparaginyl-tRNA synthetases (See IPR004364 from INTERPRO). Aminoacyl-tRNA synthetases catalyse the addition of an amino acid to the appropriate tRNA molecule 6.1.1 from EC. This domain is found in RecG helicase involved in DNA repair. Replication factor A is a heterotrimeric complex, that contains a subunit in this family [, ]. This domain is also found at the C terminus of bacterial DNA polymerase III alpha chain.; GO: 0003676 nucleic acid binding; PDB: 1BBU_A 1KRS_A 1BBW_A 1KRT_A 1EQR_B 1IL2_B 1C0A_A 3KFU_A 1EOV_A 1ASY_A ....
Probab=24.48  E-value=73  Score=17.17  Aligned_cols=20  Identities=15%  Similarity=0.320  Sum_probs=17.4

Q ss_pred             CcceeEeeCCCCcEEEEech
Q 048574           39 GVTRYALNAETGELIFGTYE   58 (65)
Q Consensus        39 gV~~Y~Ld~~tG~F~V~~y~   58 (65)
                      .+..++|++.||..++..+.
T Consensus        16 ~~~~~~l~D~tg~i~~~~~~   35 (75)
T PF01336_consen   16 KIVFFTLEDGTGSIQVVFFN   35 (75)
T ss_dssp             TEEEEEEEETTEEEEEEEET
T ss_pred             CEEEEEEEECCccEEEEEcc
Confidence            45688999999999999988


No 62 
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like. Salicylaldehyde dehydrogenase (DoxF, SaliADH, EC=1.2.1.65) involved in the upper naphthalene catabolic pathway of Pseudomonas strain C18 and other similar sequences are present in this CD.
Probab=24.46  E-value=49  Score=24.86  Aligned_cols=16  Identities=31%  Similarity=0.470  Sum_probs=13.6

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       143 ~l~~~~~~aGlP~gv~  158 (432)
T cd07105         143 LIGRVFHEAGLPKGVL  158 (432)
T ss_pred             HHHHHHHHcCcCCCcE
Confidence            4689999999999876


No 63 
>PRK05863 sulfur carrier protein ThiS; Provisional
Probab=24.41  E-value=80  Score=18.04  Aligned_cols=36  Identities=19%  Similarity=0.327  Sum_probs=22.9

Q ss_pred             CCCCHHHHHhhCCCCC---------cCCCCCcceeEeeCCCCcEEE
Q 048574           18 SEPSAYDVLQEYDFPV---------GILPKGVTRYALNAETGELIF   54 (65)
Q Consensus        18 ~~~t~yelL~~ygLP~---------GLLP~gV~~Y~Ld~~tG~F~V   54 (65)
                      +..|+.|+|++.|+|.         +++|+.--+..|.+. -+.++
T Consensus        14 ~~~tl~~ll~~l~~~~~~vav~~N~~iv~r~~~~~~L~~g-D~ieI   58 (65)
T PRK05863         14 EQTTVAALLDSLGFPEKGIAVAVDWSVLPRSDWATKLRDG-ARLEV   58 (65)
T ss_pred             CCCcHHHHHHHcCCCCCcEEEEECCcCcChhHhhhhcCCC-CEEEE
Confidence            4568999999999985         566753333336532 34444


No 64 
>TIGR02174 CXXU_selWTH selT/selW/selH selenoprotein domain. This model represents a domain found in both bacteria and animals, including animal proteins SelT, SelW, and SelH, all of which are selenoproteins. In a CXXC motif near the N-terminus of the domain, selenocysteine may replace the second Cys. Proteins with this domain may include an insert of about 70 amino acids. This model is broader than the current SelW model pfam05169 in Pfam.
Probab=24.12  E-value=70  Score=18.80  Aligned_cols=15  Identities=20%  Similarity=0.133  Sum_probs=10.7

Q ss_pred             eeCCCCcEEEEechh
Q 048574           45 LNAETGELIFGTYEQ   59 (65)
Q Consensus        45 Ld~~tG~F~V~~y~~   59 (65)
                      ..+++|.|+|.+-++
T Consensus        36 ~~~~~G~Fev~~~g~   50 (72)
T TIGR02174        36 TPPTTGAFEVTVNGQ   50 (72)
T ss_pred             ecCCCcEEEEEECCE
Confidence            345789999987443


No 65 
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like. Uncharacterized aldehyde dehydrogenase from Candidatus pelagibacter (DhaS) and other related sequences are present in this CD.
Probab=23.97  E-value=49  Score=24.96  Aligned_cols=16  Identities=25%  Similarity=0.530  Sum_probs=13.2

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       164 ~l~~~l~~aglP~~vv  179 (457)
T cd07114         164 ELAKLAEEAGFPPGVV  179 (457)
T ss_pred             HHHHHHHHcCcCCCcE
Confidence            3689999999999854


No 66 
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like. 4-hydroxymuconic semialdehyde dehydrogenase (HapE, EC=1.2.1.61) of Pseudomonas fluorescens ACB involved in 4-hydroxyacetophenone degradation, and putative hydroxycaproate semialdehyde dehydrogenase (ChnE) of Brachymonas petroleovorans involved in cyclohexane metabolism, and other similar sequences, are present in this CD.
Probab=23.92  E-value=46  Score=25.10  Aligned_cols=17  Identities=29%  Similarity=0.645  Sum_probs=13.9

Q ss_pred             CHHHHHhhCCCCCcCCC
Q 048574           21 SAYDVLQEYDFPVGILP   37 (65)
Q Consensus        21 t~yelL~~ygLP~GLLP   37 (65)
                      -+.+++++.|||.|++-
T Consensus       162 ~l~~~~~~aGlP~~~~~  178 (453)
T cd07115         162 RIAELMAEAGFPAGVLN  178 (453)
T ss_pred             HHHHHHHhcCcCchheE
Confidence            36799999999988763


No 67 
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like. Included in this CD is the L-sorbosone dehydrogenase (SNDH) from Gluconobacter oxydans UV10. In G. oxydans,  D-sorbitol is converted to 2-keto-L-gulonate (a precursor of L-ascorbic acid) in sequential oxidation steps catalyzed by a FAD-dependent, L-sorbose dehydrogenase and an NAD(P)+-dependent,  L-sorbosone dehydrogenase.
Probab=23.77  E-value=51  Score=25.04  Aligned_cols=16  Identities=25%  Similarity=0.511  Sum_probs=13.3

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       164 ~l~~~~~~aG~P~g~~  179 (454)
T cd07118         164 MLAELLIEAGLPAGVV  179 (454)
T ss_pred             HHHHHHHhcCCCccce
Confidence            3678999999998865


No 68 
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed
Probab=23.74  E-value=49  Score=25.35  Aligned_cols=16  Identities=25%  Similarity=0.463  Sum_probs=13.6

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+-+++++.|||.|++
T Consensus       168 ~l~~l~~~aGlP~gvv  183 (457)
T PRK09406        168 YLADLFRRAGFPDGCF  183 (457)
T ss_pred             HHHHHHHHhCCCcCcE
Confidence            3678999999999985


No 69 
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase. Members of this protein family are 2-hydroxymuconic semialdehyde dehydrogenase. Many aromatic compounds are catabolized by way of the catechol, via the meta-cleavage pathway, to pyruvate and acetyl-CoA. This enzyme performs the second of seven steps in that pathway for catechol degradation.
Probab=23.69  E-value=51  Score=25.24  Aligned_cols=16  Identities=19%  Similarity=0.355  Sum_probs=13.5

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|.+
T Consensus       184 ~l~~l~~~aglP~g~~  199 (481)
T TIGR03216       184 LLGEVMNAVGVPKGVY  199 (481)
T ss_pred             HHHHHHHHcCCCcCce
Confidence            4689999999998876


No 70 
>PF02760 HIN:  HIN-200/IF120x domain;  InterPro: IPR004021 This domain has no known function. It is found in one or two copies per protein, and is found associated with the PAAD/DAPIN domain IPR004020 from INTERPRO.; PDB: 3RN2_A 3RN5_C 2OQ0_A 3B6Y_A 3RLN_A 3RNU_A 3RLO_A.
Probab=23.33  E-value=69  Score=23.11  Aligned_cols=20  Identities=25%  Similarity=0.418  Sum_probs=18.2

Q ss_pred             ceeEeeCCCCcEEEEechhh
Q 048574           41 TRYALNAETGELIFGTYEQQ   60 (65)
Q Consensus        41 ~~Y~Ld~~tG~F~V~~y~~~   60 (65)
                      +-|++.++||+-+|-.|+++
T Consensus       132 ~~YeI~DnTG~MeVvv~G~~  151 (170)
T PF02760_consen  132 TIYEIQDNTGKMEVVVYGKW  151 (170)
T ss_dssp             EEEEEEETTEEEEEEEEGGG
T ss_pred             EEEEEecCCCcEEEEEeccC
Confidence            57999999999999999985


No 71 
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like. NAD+-dependent, homodimeric, phenylacetaldehyde dehydrogenase (PADH, EC=1.2.1.39) PadA of Escherichia coli involved in the catabolism of 2-phenylethylamine, and other related sequences, are present in this CD. Also included is the Pseudomonas fluorescens ST StyD PADH involved in styrene catabolism, the Sphingomonas sp. LB126 FldD protein involved in fluorene degradation, and the Novosphingobium aromaticivorans NahF salicylaldehyde dehydrogenase involved in the NAD+-dependent conversion of salicylaldehyde to salicylate.
Probab=23.17  E-value=53  Score=25.14  Aligned_cols=16  Identities=25%  Similarity=0.488  Sum_probs=13.1

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       187 ~l~~~~~~aglP~gvv  202 (477)
T cd07113         187 RVAELAKEAGIPDGVL  202 (477)
T ss_pred             HHHHHHHHcCcCCCcE
Confidence            3588999999998865


No 72 
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.
Probab=23.10  E-value=51  Score=24.65  Aligned_cols=16  Identities=25%  Similarity=0.576  Sum_probs=13.6

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       162 ~l~~~l~~aglP~g~v  177 (451)
T cd07103         162 ALAELAEEAGLPAGVL  177 (451)
T ss_pred             HHHHHHHHcCCCcccE
Confidence            4689999999999965


No 73 
>PRK13495 chemoreceptor glutamine deamidase CheD; Provisional
Probab=23.00  E-value=1.5e+02  Score=20.44  Aligned_cols=39  Identities=18%  Similarity=0.318  Sum_probs=29.1

Q ss_pred             CCHHHHHhhCCCCC------cCCCCCcceeEeeCCCCcEEEEechhhh
Q 048574           20 PSAYDVLQEYDFPV------GILPKGVTRYALNAETGELIFGTYEQQL   61 (65)
Q Consensus        20 ~t~yelL~~ygLP~------GLLP~gV~~Y~Ld~~tG~F~V~~y~~~~   61 (65)
                      ..+-++|+++|+|.      |--++.|   .|+..||+..|+.-....
T Consensus       108 ~~a~~~L~~~gI~i~a~dvGG~~gR~i---~f~~~tG~v~vk~~~~~~  152 (159)
T PRK13495        108 EAVKKHLKDFGIKLVAEDTGGNRARSI---EYNIETGKLLVRKVGGGE  152 (159)
T ss_pred             HHHHHHHHHcCCcEEEEeCCCCCCcEE---EEECCCCEEEEEEcCCCc
Confidence            46789999999995      5444444   677888999998766544


No 74 
>PRK13490 chemoreceptor glutamine deamidase CheD; Provisional
Probab=22.87  E-value=1.4e+02  Score=20.47  Aligned_cols=38  Identities=16%  Similarity=0.290  Sum_probs=29.6

Q ss_pred             CCHHHHHhhCCCCC------cCCCCCcceeEeeCCCCcEEEEechhh
Q 048574           20 PSAYDVLQEYDFPV------GILPKGVTRYALNAETGELIFGTYEQQ   60 (65)
Q Consensus        20 ~t~yelL~~ygLP~------GLLP~gV~~Y~Ld~~tG~F~V~~y~~~   60 (65)
                      ..+-++|+++|+|.      |-..+.+   .|+..||+..|....++
T Consensus       115 ~~a~~~L~~~gI~i~a~dvGG~~gR~i---~f~~~tG~v~vk~~~~~  158 (162)
T PRK13490        115 KAVKKKLKELSIPILAEDIGGNKGRTM---IFDTSDGKVYIKTVGLG  158 (162)
T ss_pred             HHHHHHHHHcCCcEEEEECCCCCCcEE---EEECCCCEEEEEEcCCC
Confidence            46789999999995      5555555   57778899999977644


No 75 
>PF11823 DUF3343:  Protein of unknown function (DUF3343);  InterPro: IPR021778  This family of proteins are functionally uncharacterised. This protein is found in bacteria and archaea. Proteins in this family are typically between 78 to 102 amino acids in length. 
Probab=22.79  E-value=20  Score=20.84  Aligned_cols=26  Identities=27%  Similarity=0.519  Sum_probs=19.4

Q ss_pred             cccCCCCCCHHHHHhhCCCCCcCCCC
Q 048574           13 FASADSEPSAYDVLQEYDFPVGILPK   38 (65)
Q Consensus        13 ~~s~~~~~t~yelL~~ygLP~GLLP~   38 (65)
                      |.|+...--+.++|++.|++.-|.|.
T Consensus         8 F~st~~a~~~ek~lk~~gi~~~liP~   33 (73)
T PF11823_consen    8 FPSTHDAMKAEKLLKKNGIPVRLIPT   33 (73)
T ss_pred             ECCHHHHHHHHHHHHHCCCcEEEeCC
Confidence            34444455678999999999999883


No 76 
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like. Vanillin dehydrogenase (Vdh, VaniDH) involved in the metabolism of ferulic acid and other related  sequences are included in this CD.  The E. coli vanillin dehydrogenase (LigV) preferred NAD+ to NADP+  and exhibited a broad substrate preference, including vanillin,  benzaldehyde, protocatechualdehyde, m-anisaldehyde, and p-hydroxybenzaldehyde.
Probab=22.75  E-value=53  Score=24.63  Aligned_cols=16  Identities=19%  Similarity=0.594  Sum_probs=13.5

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       164 ~l~~~~~~ag~P~g~v  179 (451)
T cd07150         164 KIAEIMEEAGLPKGVF  179 (451)
T ss_pred             HHHHHHHHhCCCcCcE
Confidence            3579999999999975


No 77 
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1). Both these proteins are 3'-to-5'exoribonucleases. YhaM requires Mn2+ or Co2+ for activity and is inactive in the presence of Mg2+. YhaM also has a Mn2+ dependent 3'-to-5'single-stranded DNA exonuclease activity. SaCBF is also a double-stranded DNA binding protein, binding specifically to cmp, the replication enhancer found in S. aureus plasmid pT181. Proteins in this group combine an N-terminal OB fold with a C-terminal HD domain. The HD domain is found in metal-dependent phosphohydrolases.
Probab=22.63  E-value=1e+02  Score=16.89  Aligned_cols=21  Identities=19%  Similarity=0.289  Sum_probs=17.3

Q ss_pred             cceeEeeCCCCcEEEEechhh
Q 048574           40 VTRYALNAETGELIFGTYEQQ   60 (65)
Q Consensus        40 V~~Y~Ld~~tG~F~V~~y~~~   60 (65)
                      ...++|++.+|.+++..++.+
T Consensus        20 ~~~~~l~D~tg~i~~~~f~~~   40 (83)
T cd04492          20 YLALTLQDKTGEIEAKLWDAS   40 (83)
T ss_pred             EEEEEEEcCCCeEEEEEcCCC
Confidence            357889999999999999843


No 78 
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed
Probab=22.61  E-value=52  Score=25.75  Aligned_cols=16  Identities=25%  Similarity=0.428  Sum_probs=13.5

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       199 ~l~~ll~eaGlP~gvv  214 (524)
T PRK09407        199 AAVELLYEAGLPRDLW  214 (524)
T ss_pred             HHHHHHHHcCCCcccE
Confidence            3579999999999876


No 79 
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like. NAD-dependent, benzaldehyde dehydrogenase II (XylC, BenzADH, EC=1.2.1.28) is involved in the oxidation of benzyl alcohol to benzoate. In Acinetobacter calcoaceticus, this process is carried out by the chromosomally encoded, benzyl alcohol dehydrogenase (xylB) and benzaldehyde dehydrogenase II (xylC) enzymes; whereas in Pseudomonas putida they are encoded by TOL plasmids.
Probab=22.53  E-value=54  Score=24.65  Aligned_cols=15  Identities=27%  Similarity=0.603  Sum_probs=12.7

Q ss_pred             HHHHHhhCCCCCcCC
Q 048574           22 AYDVLQEYDFPVGIL   36 (65)
Q Consensus        22 ~yelL~~ygLP~GLL   36 (65)
                      +.++|++.|||.|++
T Consensus       157 l~~~~~~ag~P~gvv  171 (443)
T cd07152         157 IARLFEEAGLPAGVL  171 (443)
T ss_pred             HHHHHHHhCcCcCcE
Confidence            358899999999985


No 80 
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like. Uncharacterized aldehyde dehydrogenase of Saccharopolyspora spinosa (AAS00426) and other similar sequences, are present in this CD.
Probab=22.50  E-value=56  Score=24.66  Aligned_cols=16  Identities=25%  Similarity=0.468  Sum_probs=13.6

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       162 ~l~~~~~~aGlP~gv~  177 (454)
T cd07109         162 RLAELAEEAGLPAGAL  177 (454)
T ss_pred             HHHHHHHHcCcCccce
Confidence            3678999999999976


No 81 
>PF02655 ATP-grasp_3:  ATP-grasp domain;  InterPro: IPR003806  The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule []. This fold is found in many different enzyme families, including various peptide synthetases, biotin carboxylase, synapsin, succinyl-CoA synthetase, pyruvate phosphate dikinase, and glutathione synthetase, amongst others []. These enzymes contribute predominantly to macromolecular synthesis, using ATP-hydrolysis to activate their substrates.  The ATP-grasp fold shares functional and structural similarities with the PIPK (phosphatidylinositol phosphate kinase) and protein kinase superfamilies. The ATP-grasp domain consists of two subdomains with different alpha+beta folds, which grasp the ATP molecule between them. Each subdomain provides a variable loop that forms part of the active site, with regions from other domains also contributing to the active site, even though these other domains are not conserved between the various ATP-grasp enzymes []. This entry describes a type of ATP-grasp fold that is found in a set of proteins of unknown function.; GO: 0005524 ATP binding, 0046872 metal ion binding; PDB: 3DF7_A.
Probab=22.38  E-value=99  Score=20.10  Aligned_cols=32  Identities=19%  Similarity=0.411  Sum_probs=14.7

Q ss_pred             CHHHHHhhCCCCCcCCCCCcceeEeeCCCCcEEEE
Q 048574           21 SAYDVLQEYDFPVGILPKGVTRYALNAETGELIFG   55 (65)
Q Consensus        21 t~yelL~~ygLP~GLLP~gV~~Y~Ld~~tG~F~V~   55 (65)
                      -.++.|++.|+|   .|+.+.....+...+.+-++
T Consensus         6 ~~~~~L~~~gi~---~P~~~~~~~~~~~~~~~viK   37 (161)
T PF02655_consen    6 KTYKFLKELGIP---VPTTLRDSEPEPIDGPWVIK   37 (161)
T ss_dssp             HHHHHHTTT-S-----------EESS--SSSEEEE
T ss_pred             HHHHHHHccCCC---CCCccccccccccCCcEEEE
Confidence            468999999998   67666666655555555544


No 82 
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like. NADP+-dependent, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase (GABALDH) PuuC of  Escherichia coli which catalyzes the conversion of putrescine to 4-aminobutanoate and other similar sequences are present in this CD.
Probab=22.33  E-value=56  Score=24.91  Aligned_cols=17  Identities=24%  Similarity=0.434  Sum_probs=13.8

Q ss_pred             CHHHHHhhCCCCCcCCC
Q 048574           21 SAYDVLQEYDFPVGILP   37 (65)
Q Consensus        21 t~yelL~~ygLP~GLLP   37 (65)
                      -+.++|++.|||.|++-
T Consensus       169 ~l~~~~~~aGlP~g~v~  185 (462)
T cd07112         169 RLAELALEAGLPAGVLN  185 (462)
T ss_pred             HHHHHHHhcCCCCCcEE
Confidence            46789999999998663


No 83 
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins. The 6-oxolauric acid dehydrogenase (CddD) from Rhodococcus ruber SC1 which converts 6-oxolauric acid to dodecanedioic acid; and the aldehyde dehydrogenase (locus SSP0762) from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 and also, the Mycobacterium tuberculosis H37Rv ALDH AldA (locus Rv0768) sequence; and other similar sequences, are included in this CD.
Probab=22.33  E-value=56  Score=24.86  Aligned_cols=16  Identities=25%  Similarity=0.598  Sum_probs=13.3

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       168 ~l~~~~~~aglP~g~~  183 (459)
T cd07089         168 LLGEIIAETDLPAGVV  183 (459)
T ss_pred             HHHHHHHHcCCCccce
Confidence            4689999999998865


No 84 
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE). The DNA polymerase holoenzyme of E. coli contains two copies of this replicative polymerase, each of which copies a different DNA strand. This group also contains Bacillus subtilis DnaE. Replication in B. subtilis and Staphylococcus aureus requires two different type C polymerases, polC and DnaE, both of which are thought to be included in the DNA polymerase holoenzyme. At the B. subtilis replication fork, polC appears to be involved in leading strand synthesis and DnaE in lagging strand synthesis.
Probab=22.03  E-value=1.2e+02  Score=16.20  Aligned_cols=21  Identities=14%  Similarity=0.180  Sum_probs=17.4

Q ss_pred             ceeEeeCCCCcEEEEechhhh
Q 048574           41 TRYALNAETGELIFGTYEQQL   61 (65)
Q Consensus        41 ~~Y~Ld~~tG~F~V~~y~~~~   61 (65)
                      ...++.+.+|.+++..++++.
T Consensus        21 ~~~~l~D~tg~~~~~~f~~~~   41 (84)
T cd04485          21 AFVTLEDLTGSIEVVVFPETY   41 (84)
T ss_pred             EEEEEEeCCCeEEEEECHHHH
Confidence            567888889999999998764


No 85 
>cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH).  The archeal CPSFs are predicted to be metal-dependent RNases belonging to the beta-CASP family, a subgroup enzymes within the metallo-beta-lactamase fold.  The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices.  In general, KH domains are known to bind single-stranded RNA or DNA and are found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.
Probab=21.97  E-value=1e+02  Score=21.46  Aligned_cols=32  Identities=31%  Similarity=0.596  Sum_probs=23.4

Q ss_pred             CCCHHHHHhhCCCCCcCCC--CCcceeEeeCCCCcEEEEe
Q 048574           19 EPSAYDVLQEYDFPVGILP--KGVTRYALNAETGELIFGT   56 (65)
Q Consensus        19 ~~t~yelL~~ygLP~GLLP--~gV~~Y~Ld~~tG~F~V~~   56 (65)
                      ...+-++.++      +.|  .++++..||+++|+-.+..
T Consensus        51 ~e~A~~~I~~------ivP~ea~i~di~Fd~~tGEV~Iea   84 (145)
T cd02410          51 PEEAIKIILE------IVPEEAGITDIYFDDDTGEVIIEA   84 (145)
T ss_pred             HHHHHHHHHH------hCCCccCceeeEecCCCcEEEEEE
Confidence            3455566655      566  5789999999999877664


No 86 
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like. NAD(P)+-dependent aldehyde dehydrogenase (AldA) of Aspergillus nidulans (locus AN0554), and other similar sequences, are present in this CD.
Probab=21.90  E-value=57  Score=25.19  Aligned_cols=17  Identities=24%  Similarity=0.516  Sum_probs=14.1

Q ss_pred             CHHHHHhhCCCCCcCCC
Q 048574           21 SAYDVLQEYDFPVGILP   37 (65)
Q Consensus        21 t~yelL~~ygLP~GLLP   37 (65)
                      -+.++|++.|||.|++-
T Consensus       189 ~l~~~l~~aGlP~g~v~  205 (481)
T cd07143         189 YMTKLIPEAGFPPGVIN  205 (481)
T ss_pred             HHHHHHHhcCcCcccEE
Confidence            36889999999999763


No 87 
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. Uncharacterized aldehyde dehydrogenase family 16 member A1 (ALDH16A1) and other related sequences are present in this CD. The active site cysteine and glutamate residues are not conserved in the human ALDH16A1 protein sequence.
Probab=21.72  E-value=55  Score=25.37  Aligned_cols=16  Identities=25%  Similarity=0.428  Sum_probs=13.5

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       192 ~l~~~~~~aGlP~gvv  207 (480)
T cd07111         192 LFAEICAEAGLPPGVL  207 (480)
T ss_pred             HHHHHHHhcCCCcccE
Confidence            3688999999999965


No 88 
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase  AldA-like. The Mycobacterium tuberculosis NAD+-dependent, aldehyde dehydrogenase  PDB structure,  3B4W, and the Mycobacterium tuberculosis H37Rv aldehyde dehydrogenase  AldA (locus Rv0768) sequence, as well as the Rhodococcus rhodochrous ALDH involved in haloalkane catabolism, and other similar sequences, are included in this CD.
Probab=21.29  E-value=62  Score=24.56  Aligned_cols=16  Identities=19%  Similarity=0.389  Sum_probs=13.9

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.++|++.|||.|++
T Consensus       182 ~l~~~~~~aglP~gv~  197 (471)
T cd07139         182 LLAEAAEEAGLPPGVV  197 (471)
T ss_pred             HHHHHHHHcCCCCCcE
Confidence            4689999999999976


No 89 
>COG3812 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.21  E-value=52  Score=24.05  Aligned_cols=16  Identities=25%  Similarity=0.524  Sum_probs=14.2

Q ss_pred             CCHHHHHhhCCCCCcC
Q 048574           20 PSAYDVLQEYDFPVGI   35 (65)
Q Consensus        20 ~t~yelL~~ygLP~GL   35 (65)
                      .++|++|+.+|.+.|=
T Consensus       171 TtAYaiLRHnGVelGK  186 (193)
T COG3812         171 TTAYAILRHNGVELGK  186 (193)
T ss_pred             HHHHHHHHhcCccccc
Confidence            4899999999999884


No 90 
>TIGR02904 spore_ysxE spore coat protein YsxE. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YsxE, are found only in the family Bacillaceae, from among the endospore-forming members of the Firmicutes branch of the Bacteria. As a rule, the ysxE gene is found immediately downstream of spoVID, a gene necessary for spore coat assembly. The protein has been shown to be part of the spore coat.
Probab=21.00  E-value=1.4e+02  Score=21.11  Aligned_cols=36  Identities=11%  Similarity=0.187  Sum_probs=25.4

Q ss_pred             HHHhhCCCCCc-CCCCCcceeEeeCCCCcEEEEechh
Q 048574           24 DVLQEYDFPVG-ILPKGVTRYALNAETGELIFGTYEQ   59 (65)
Q Consensus        24 elL~~ygLP~G-LLP~gV~~Y~Ld~~tG~F~V~~y~~   59 (65)
                      ++|++||+.+= +-|---+.|.++.++|.|-+..+..
T Consensus         3 ~vl~~Y~l~v~~i~~~~~~v~~v~T~~G~~~Lk~~~~   39 (309)
T TIGR02904         3 AVLEHYGLQPEEMEQVTGKLFKVYTDQGVFALKKLYA   39 (309)
T ss_pred             hhHhhcCCCceeeecccCcEEEEEeCCCCEEEEEecc
Confidence            67889988532 3221114599999999999998763


No 91 
>PF01011 PQQ:  PQQ enzyme repeat family.;  InterPro: IPR002372 Pyrrolo-quinoline quinone (PQQ) is a redox coenzyme, which serves as a cofactor for a number of enzymes (quinoproteins) and particularly for some bacterial dehydrogenases [, ]. A number of bacterial quinoproteins belong to this family. Enzymes in this group have repeats of a beta propeller.; PDB: 1H4I_C 1H4J_E 1W6S_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A 1G72_A ....
Probab=20.92  E-value=80  Score=16.04  Aligned_cols=12  Identities=50%  Similarity=0.908  Sum_probs=9.3

Q ss_pred             eeEeeCCCCcEE
Q 048574           42 RYALNAETGELI   53 (65)
Q Consensus        42 ~Y~Ld~~tG~F~   53 (65)
                      =|-||.+||+..
T Consensus        12 l~AlD~~TG~~~   23 (38)
T PF01011_consen   12 LYALDAKTGKVL   23 (38)
T ss_dssp             EEEEETTTTSEE
T ss_pred             EEEEECCCCCEE
Confidence            478899999864


No 92 
>PF02983 Pro_Al_protease:  Alpha-lytic protease prodomain;  InterPro: IPR004236 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. The alpha-lytic protease prodomain is associated with serine peptidases, specifically the alpha-lytic endopeptidases and streptogrisin A, B, C, D and E, which are bacterial enzymes and which belong to MEROPS peptidase subfamily S1A (IPR001316 from INTERPRO). The protease precursor in Gram-negative bacterial proteases may be a general property of extracellular bacterial proteases []. The proteases are encoded with a large (166 amino acid) N-terminal pro region that is required transiently both in vivo and in vitro for the correct folding of the protease domain [, ]. The pro region also acts as a potent inhibitor of the mature enzyme []. ; GO: 0008236 serine-type peptidase activity, 0006508 proteolysis, 0005576 extracellular region; PDB: 3PRO_C 2PRO_B 4PRO_C.
Probab=20.72  E-value=1.2e+02  Score=17.58  Aligned_cols=23  Identities=17%  Similarity=0.342  Sum_probs=19.6

Q ss_pred             CCCCcceeEeeCCCCcEEEEech
Q 048574           36 LPKGVTRYALNAETGELIFGTYE   58 (65)
Q Consensus        36 LP~gV~~Y~Ld~~tG~F~V~~y~   58 (65)
                      .|..++++-.|..|++..|....
T Consensus        21 ~~~~~~~WyvD~~tn~VVV~a~~   43 (62)
T PF02983_consen   21 APVAVTSWYVDPRTNKVVVTADS   43 (62)
T ss_dssp             GGGCEEEEEEECCCTEEEEEEEC
T ss_pred             CCCCcceEEEeCCCCeEEEEECC
Confidence            36789999999999999997654


No 93 
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=20.35  E-value=26  Score=20.74  Aligned_cols=29  Identities=31%  Similarity=0.511  Sum_probs=19.1

Q ss_pred             hhCCCCCcCCCCCcc-eeEeeC-CCCcEEEE
Q 048574           27 QEYDFPVGILPKGVT-RYALNA-ETGELIFG   55 (65)
Q Consensus        27 ~~ygLP~GLLP~gV~-~Y~Ld~-~tG~F~V~   55 (65)
                      ..+.+|+-.||.+++ +-.|.- ..|.|++.
T Consensus        21 ~~~~vp~~~LP~~~keGDvl~i~~~~~~~~d   51 (71)
T PF11213_consen   21 KEIDVPRSRLPEGAKEGDVLEIGEDGSIEID   51 (71)
T ss_pred             EEEEEEHHHCCCCCCcccEEEECCCceEEEC
Confidence            357789999999887 333333 45677653


No 94 
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1. Uncharacterized aldehyde dehydrogenase (ORF name y4uC) with sequence similarity to the moss Tortula ruralis aldehyde dehydrogenase ALDH21A1 (RNP123) believed to play an important role in the detoxification of aldehydes generated in response to desiccation- and salinity-stress, and similar sequences are included in this CD.
Probab=20.18  E-value=67  Score=23.99  Aligned_cols=16  Identities=31%  Similarity=0.455  Sum_probs=13.6

Q ss_pred             HHHHHhhCCCCCcCCC
Q 048574           22 AYDVLQEYDFPVGILP   37 (65)
Q Consensus        22 ~yelL~~ygLP~GLLP   37 (65)
                      +.++|++.|||.|++-
T Consensus       169 l~~~l~~ag~P~gvv~  184 (453)
T cd07149         169 LAELLLEAGLPKGALN  184 (453)
T ss_pred             HHHHHHHcCcCccceE
Confidence            6899999999988764


No 95 
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like. ALDH subfamily of the NAD+-dependent, delta(1)-pyrroline-5-carboxylate dehydrogenases (P5CDH, EC=1.5.1.12). The proline catabolic enzymes, proline dehydrogenase and P5CDH catalyze the two-step oxidation of proline to glutamate.  P5CDH catalyzes the oxidation of glutamate semialdehyde, utilizing NAD+ as the electron acceptor. In some bacteria, the two enzymes are fused into the bifunctional flavoenzyme, proline utilization A (PutA). These enzymes play important roles in cellular redox control, superoxide generation, and apoptosis. In certain prokaryotes such as Escherichia coli, PutA is also a transcriptional repressor of the proline utilization genes. Monofunctional enzyme sequences such as those seen in the Bacillus RocA P5CDH are also present in this subfamily as well as the human ALDH4A1 P5CDH and the Drosophila Aldh17 P5CDH.
Probab=20.14  E-value=68  Score=24.83  Aligned_cols=16  Identities=25%  Similarity=0.835  Sum_probs=13.6

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       199 ~l~~~~~eaGlP~gvv  214 (500)
T cd07083         199 KVFEIFHEAGFPPGVV  214 (500)
T ss_pred             HHHHHHHHcCCCCCce
Confidence            3688999999999886


No 96 
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1. Uncharacterized aldehyde dehydrogenase (locus RL0313) with sequence similarity to the moss Tortula ruralis aldehyde dehydrogenase ALDH21A1 (RNP123) believed to play an important role in the detoxification of aldehydes generated in response to desiccation- and salinity-stress, and similar sequences are included in this CD.
Probab=20.10  E-value=67  Score=24.45  Aligned_cols=16  Identities=31%  Similarity=0.457  Sum_probs=13.4

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+-+++++.|||.|++
T Consensus       169 ~l~~~~~~aGlP~gvv  184 (455)
T cd07148         169 AFVDLLHEAGLPEGWC  184 (455)
T ss_pred             HHHHHHHHcCCCcCcE
Confidence            4578899999999975


No 97 
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like. Kinetic studies of the Bacillus subtilis ALDH-like ycbD protein, which is involved in d-glucarate/d-galactarate utilization, reveal that it is a NADP+-dependent, alpha-ketoglutaric semialdehyde dehydrogenase (KGSADH). KGSADHs (EC 1.2.1.26) catalyze the NAD(P)+-dependent conversion of KGSA to alpha-ketoglutarate. Interestingly, the NADP+-dependent, tetrameric, 2,5-dioxopentanoate dehydrogenase (EC=1.2.1.26), an enzyme involved in the catabolic pathway for D-arabinose in Sulfolobus solfataricus, also clusters in this group. This CD shows a distant phylogenetic relationship to the Azospirillum brasilense KGSADH-II (-III) group.
Probab=20.10  E-value=67  Score=24.51  Aligned_cols=16  Identities=25%  Similarity=0.692  Sum_probs=13.0

Q ss_pred             CHHHHHhhCCCCCcCC
Q 048574           21 SAYDVLQEYDFPVGIL   36 (65)
Q Consensus        21 t~yelL~~ygLP~GLL   36 (65)
                      -+.+++++.|||.|++
T Consensus       180 ~l~~~~~~aGlP~gvv  195 (473)
T cd07097         180 ALVEILEEAGLPAGVF  195 (473)
T ss_pred             HHHHHHHHcCCCCcce
Confidence            4578999999998854


No 98 
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA)  to succinate.  SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731).  The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.
Probab=20.08  E-value=67  Score=24.17  Aligned_cols=17  Identities=24%  Similarity=0.614  Sum_probs=14.3

Q ss_pred             CHHHHHhhCCCCCcCCC
Q 048574           21 SAYDVLQEYDFPVGILP   37 (65)
Q Consensus        21 t~yelL~~ygLP~GLLP   37 (65)
                      .+.++|++.|||.|++-
T Consensus       141 ~l~~~l~~aglP~gvv~  157 (429)
T cd07100         141 AIEELFREAGFPEGVFQ  157 (429)
T ss_pred             HHHHHHHHcCCCcCcEE
Confidence            47899999999999764


No 99 
>PF03646 FlaG:  FlaG protein;  InterPro: IPR005186 Although these proteins are known to be important for flagellar their exact function is unknown.; PDB: 2HC5_A.
Probab=20.05  E-value=74  Score=19.59  Aligned_cols=19  Identities=16%  Similarity=0.581  Sum_probs=16.5

Q ss_pred             ceeEeeCCCCcEEEEechh
Q 048574           41 TRYALNAETGELIFGTYEQ   59 (65)
Q Consensus        41 ~~Y~Ld~~tG~F~V~~y~~   59 (65)
                      -.|++|+++|++.|.....
T Consensus        57 l~F~vde~~~~~vVkViD~   75 (107)
T PF03646_consen   57 LRFSVDEESGRVVVKVIDK   75 (107)
T ss_dssp             EEEEEEEETTEEEEEEEET
T ss_pred             eEEEEecCCCcEEEEEEEC
Confidence            5899999999999988754


Done!