Citrus Sinensis ID: 048603

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLEDIVGTLAFLPLIYPYEPWRFKHDKHHAKTNMLHGDTAWHPVWKEEFDTSPFLRKAIIYGYGPFRPWMSIAHWLIWHFDLSKFRPNEVKRVKISLACVFAFMAIGWPLIILKTGIAGWIKYWLMPWLGYHFWMSTFTMVHHTAPHIPFKSPNEWNAAQAQLNGTVHCDYPKWIEILCHNINVHIPHHISPRIPSYNLKAAHKSIQQNWGKYLNEASWNWRLMKTIMTVCHIYDKEQNYVAFDQLAPKDSQPITFLKSVMPDHA
ccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccHHHHHcccHHHHHHHHHccccHHHHHccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHccEEEECccccEEEccccccccccccccccccccccc
MISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLEDIVGTLAFLPLIYPYEPWRFKHDKHHAKTNMLHGDTAWHPVWKEEFDTSPFLRKAIIYGYGPFRPWMSIAHWLIWHFDLSKFRPNEVKRVKISLACVFAFMAIGWPLIILKTGIAGWIKYWLMPWLGYHFWMSTFTMVHHTAPHIPFKSPNEWNAAQAQLNGTVHCDYPKWIEILCHNINVHIPHHISPRIPSYNLKAAHKSIQQNWGKYLNEASWNWRLMKTIMTVCHIYDKEQNYVAFDQLA******************
xxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISKAPWYLLPLAWAWTGTAVTGFFVIGHDCAHKSFSKNKLLEDIVGTLAFLPLIYPYEPWRFKHDKHHAKTNMLHGDTAWHPVWKEEFDTSPFLRKAIIYGYGPFRPWMSIAHWLIWHFDLSKFRPNEVKRVKISLACVFAFMAIGWPLIILKTGIAGWIKYWLMPWLGYHFWMSTFTMVHHTAPHIPFKSPNEWNAAQAQLNGTVHCDYPKWIEILCHNINVHIPHHISPRIPSYNLKAAHKSIQQNWGKYLNEASWNWRLMKTIMTVCHIYDKEQNYVAFDQLAPKDSQPITFLKSVMPDHA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Omega-6 fatty acid desaturase, chloroplastic Chloroplast omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes. It is thought to use ferredoxin as an electron donor and to act on fatty acids esterified to galactolipids, sulfolipids and phosphatidylglycerol.probableP48628
Omega-6 fatty acid desaturase, chloroplastic Chloroplast omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes. It is thought to use ferredoxin as an electron donor and to act on fatty acids esterified to galactolipids, sulfolipids and phosphatidylglycerol.probableP46312
Omega-6 fatty acid desaturase, chloroplastic Chloroplast omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes. It is thought to use ferredoxin as an electron donor and to act on fatty acids esterified to galactolipids, sulfolipids and phosphatidylglycerol.probableP48629

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted