Query         048756
Match_columns 218
No_of_seqs    137 out of 304
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 12:50:17 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/048756.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/048756hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14009 DUF4228:  Domain of un 100.0 8.2E-38 1.8E-42  251.8   8.1  107    1-130     1-107 (181)
  2 TIGR03793 TOMM_pelo TOMM prope  78.8     2.5 5.3E-05   31.9   3.2   25   94-119    51-75  (77)
  3 PF02824 TGS:  TGS domain;  Int  70.6     7.2 0.00016   27.3   3.7   26   31-56      1-26  (60)
  4 cd00178 STI Soybean trypsin in  45.8      14  0.0003   31.3   1.8   19   88-106     6-24  (172)
  5 PRK05659 sulfur carrier protei  45.6      21 0.00046   24.7   2.5   23   34-56      3-25  (66)
  6 TIGR01683 thiS thiamine biosyn  45.3      30 0.00065   24.2   3.2   23   34-56      1-23  (64)
  7 PF00197 Kunitz_legume:  Trypsi  45.3      17 0.00036   30.8   2.3   20   88-107     6-25  (176)
  8 cd01668 TGS_RelA_SpoT TGS_RelA  44.6      34 0.00073   22.5   3.3   25   32-56      2-26  (60)
  9 TIGR01323 nitrile_alph nitrile  44.5      23 0.00049   31.1   3.0   37   86-122   132-174 (185)
 10 PF15386 Tantalus:  Drosophila   40.1     9.4  0.0002   27.9  -0.0   12  203-214    31-43  (61)
 11 PRK00994 F420-dependent methyl  37.4   1E+02  0.0022   28.6   6.1   84   27-130    60-148 (277)
 12 cd00565 ThiS ThiaminS ubiquiti  35.5      51  0.0011   23.0   3.2   23   34-56      2-24  (65)
 13 PRK07440 hypothetical protein;  35.2      38 0.00082   24.5   2.5   25   32-56      5-29  (70)
 14 PRK06944 sulfur carrier protei  34.4      40 0.00088   23.2   2.5   23   34-56      3-25  (65)
 15 PRK05863 sulfur carrier protei  33.9      42  0.0009   23.7   2.5   23   34-56      3-25  (65)
 16 PRK08053 sulfur carrier protei  32.8      45 0.00098   23.5   2.5   23   34-56      3-25  (66)
 17 smart00452 STI Soybean trypsin  31.9      30 0.00065   29.3   1.8   18   88-105     5-22  (172)
 18 PF02597 ThiS:  ThiS family;  I  26.7      12 0.00027   26.1  -1.2   18   39-56     14-31  (77)
 19 PF08428 Rib:  Rib/alpha-like r  25.8      28 0.00062   24.9   0.5   23   28-50     42-64  (65)
 20 COG2895 CysN GTPases - Sulfate  25.7      22 0.00049   34.6  -0.1   68   28-102   265-337 (431)
 21 PRK06083 sulfur carrier protei  25.0      68  0.0015   24.3   2.5   25   32-56     19-43  (84)
 22 PRK06437 hypothetical protein;  25.0 1.9E+02  0.0041   20.6   4.7   52   34-100     5-61  (67)
 23 PRK07696 sulfur carrier protei  24.2      76  0.0016   22.6   2.5   23   34-56      3-26  (67)
 24 PF10857 DUF2701:  Protein of u  24.0      23  0.0005   26.2  -0.3   16  191-213    36-51  (63)
 25 PF01993 MTD:  methylene-5,6,7,  23.8      80  0.0017   29.3   3.1   83   28-130    60-147 (276)
 26 cd01616 TGS The TGS domain, na  22.4 1.5E+02  0.0033   18.3   3.5   25   32-56      2-26  (60)
 27 cd01667 TGS_ThrRS_N TGS _ThrRS  22.2 1.6E+02  0.0035   18.5   3.6   25   32-56      2-26  (61)
 28 PF02079 TP1:  Nuclear transiti  20.8      47   0.001   23.6   0.8   32  176-207    18-52  (54)
 29 PF05833 FbpA:  Fibronectin-bin  20.3      67  0.0015   30.2   2.0   57   48-114   115-174 (455)
 30 KOG3081 Vesicle coat complex C  20.2      35 0.00076   32.0   0.1   22  195-216    47-68  (299)

No 1  
>PF14009 DUF4228:  Domain of unknown function (DUF4228)
Probab=100.00  E-value=8.2e-38  Score=251.83  Aligned_cols=107  Identities=45%  Similarity=0.671  Sum_probs=99.3

Q ss_pred             CCCccCCCCCCCCCCCCCCCCCCcCCCCCceEEEccCCcEEEecCCccHHHHHHHHHhhhcCcCCCCCeEEEccCCCCCC
Q 048756            1 MGGCFSSSSTSSPSSSSPSSPSSTSLKHSTAKVLTLKGEVAEYKVPVIVSQVLAHQLAAQADQEEAPSWFLCSSDSLLFD   80 (218)
Q Consensus         1 MGnCvS~~~~~~~~~~~~~~~~~~~~~~~taKVV~~DG~v~ef~~PvtAseVL~~~~~~~~~~~~~P~~FVC~SD~L~~~   80 (218)
                      ||||+||...             ......++|||++||+|+||+.||+|+|||.+|          |+||||+++.+.++
T Consensus         1 MGn~~~~~~~-------------~~~~~~~vkvv~~~G~v~~~~~pv~a~evm~~~----------P~h~v~~~~~~~~~   57 (181)
T PF14009_consen    1 MGNCVSCCLA-------------SSSSAATVKVVHPDGKVEEFKRPVTAAEVMLEN----------PGHFVCDSDSFRFG   57 (181)
T ss_pred             CCCccccccc-------------ccCCCceEEEEcCCCcEEEeCCCcCHHHHHHHC----------CCCEEeccccccCC
Confidence            9999999753             123568999999999999999999999999999          99999999999999


Q ss_pred             CCCCCCCCccccccCCeEEEecCCccCCCCCHHHHHHHHHHHHHHHHhcc
Q 048756           81 DYIPALDLEDELEADQIYFVLPTSKLQYKLSASDMAALAVKASLALQNAS  130 (218)
Q Consensus        81 ~~i~aL~~DeeLqpGqiYFlLP~s~l~~~LSa~dmAaLAvkAssAL~~~~  130 (218)
                      .++++|++||+|++||||||||+++++..+++.+|++++.+++.+.....
T Consensus        58 ~~~~~l~~d~~L~~G~~Y~llP~~~~~~~~~~~~~~~~~~~~~~~~~~~~  107 (181)
T PF14009_consen   58 RRIKPLPPDEELQPGQIYFLLPMSRLQSVLSASDMASLASSASSASSSSS  107 (181)
T ss_pred             CcccCCCccCeecCCCEEEEEEccccCcccccchhcccccchhhcccccc
Confidence            99999999999999999999999999999999999999999988887754


No 2  
>TIGR03793 TOMM_pelo TOMM propeptide domain. This model represents a domain that is conserved among a large number of putative thiazole/oxazole-modified microcins (TOMM). Oddly, most of this seqence region appears homologous to nitrile hydratase subunits. This family is expanded especially in Pelotomaculum thermopropionicum SI.
Probab=78.82  E-value=2.5  Score=31.90  Aligned_cols=25  Identities=28%  Similarity=0.499  Sum_probs=22.5

Q ss_pred             cCCeEEEecCCccCCCCCHHHHHHHH
Q 048756           94 ADQIYFVLPTSKLQYKLSASDMAALA  119 (218)
Q Consensus        94 pGqiYFlLP~s~l~~~LSa~dmAaLA  119 (218)
                      |...|+|||...-. .||.++|+++|
T Consensus        51 ~~~~~lVlP~~P~~-~lse~~L~~va   75 (77)
T TIGR03793        51 PTVLYLVLPVNPDI-ELTDEQLDAVA   75 (77)
T ss_pred             CCeEEEEecCCCCC-CCCHHHHHHhh
Confidence            68999999998887 99999999875


No 3  
>PF02824 TGS:  TGS domain;  InterPro: IPR004095  The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) []. The TGS domain is also present at the amino terminus of the uridine kinase from the spirochaete Treponema pallidum (but not any other organism, including the related spirochaete Borrelia burgdorferi).  TGS is a small domain that consists of ~50 amino acid residues and is predicted to possess a predominantly beta-sheet structure. There is no direct information on the functions of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role []. ; PDB: 1WXQ_A 1NYR_B 1NYQ_B 2KMM_A 1WWT_A 1TKE_A 1TKG_A 1TJE_A 1QF6_A 1TKY_A ....
Probab=70.64  E-value=7.2  Score=27.34  Aligned_cols=26  Identities=19%  Similarity=0.126  Sum_probs=23.4

Q ss_pred             eEEEccCCcEEEecCCccHHHHHHHH
Q 048756           31 AKVLTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        31 aKVV~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      ++|..+||++.+|+..+|+.|+...-
T Consensus         1 I~v~lpdG~~~~~~~g~T~~d~A~~I   26 (60)
T PF02824_consen    1 IRVYLPDGSIKELPEGSTVLDVAYSI   26 (60)
T ss_dssp             EEEEETTSCEEEEETTBBHHHHHHHH
T ss_pred             CEEECCCCCeeeCCCCCCHHHHHHHH
Confidence            57889999999999999999998775


No 4  
>cd00178 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors. Inhibit proteases by binding with high affinity to their active sites. Trefoil fold, common to interleukins and fibroblast growth factors.
Probab=45.80  E-value=14  Score=31.30  Aligned_cols=19  Identities=21%  Similarity=0.394  Sum_probs=16.5

Q ss_pred             CccccccCCeEEEecCCcc
Q 048756           88 LEDELEADQIYFVLPTSKL  106 (218)
Q Consensus        88 ~DeeLqpGqiYFlLP~s~l  106 (218)
                      .+++|++|.-||+||..+-
T Consensus         6 ~G~~l~~g~~YyI~p~~~g   24 (172)
T cd00178           6 DGNPLRNGGRYYILPAIRG   24 (172)
T ss_pred             CCCCCcCCCeEEEEEceeC
Confidence            4688999999999999864


No 5  
>PRK05659 sulfur carrier protein ThiS; Validated
Probab=45.61  E-value=21  Score=24.74  Aligned_cols=23  Identities=30%  Similarity=0.364  Sum_probs=21.3

Q ss_pred             EccCCcEEEecCCccHHHHHHHH
Q 048756           34 LTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        34 V~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      |..||+..++..+.++.|+|...
T Consensus         3 i~vNG~~~~~~~~~tl~~lL~~l   25 (66)
T PRK05659          3 IQLNGEPRELPDGESVAALLARE   25 (66)
T ss_pred             EEECCeEEEcCCCCCHHHHHHhc
Confidence            67899999999999999999876


No 6  
>TIGR01683 thiS thiamine biosynthesis protein ThiS. This model represents ThiS, a small thiamine-biosynthesis protein related to MoaD, a molybdenum cofactor biosynthesis protein. Both proteins are involved in sulfur transfer. ThiS has a conserved Gly-Gly C-terminus that is modified, in reactions requiring ThiI, ThiF, IscS, and a sulfur atom from Cys, into the thiocarboxylate that provides the sulfur for thiazole biosynthesis.
Probab=45.35  E-value=30  Score=24.15  Aligned_cols=23  Identities=22%  Similarity=0.342  Sum_probs=20.9

Q ss_pred             EccCCcEEEecCCccHHHHHHHH
Q 048756           34 LTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        34 V~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      |..||+..++..+.++.|+|...
T Consensus         1 i~iNg~~~~~~~~~tv~~ll~~l   23 (64)
T TIGR01683         1 ITVNGEPVEVEDGLTLAALLESL   23 (64)
T ss_pred             CEECCeEEEcCCCCcHHHHHHHc
Confidence            46799999999999999999987


No 7  
>PF00197 Kunitz_legume:  Trypsin and protease inhibitor;  InterPro: IPR002160 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The Kunitz-type soybean trypsin inhibitor (STI) family consists mainly of proteinase inhibitors from Leguminosae seeds []. They belong to MEROPS inhibitor family I3, clan IC. They exhibit proteinase inhibitory activity against serine proteinases; trypsin (MEROPS peptidase family S1, IPR001254 from INTERPRO) and subtilisin (MEROPS peptidase family S8, IPR000209 from INTERPRO), thiol proteinases (MEROPS peptidase family C1, IPR000668 from INTERPRO) and aspartic proteinases (MEROPS peptidase family A1, IPR001461 from INTERPRO) [].  Inhibitors from cereals are active against subtilisin and endogenous alpha-amylases, while some also inhibit tissue plasminogen activator. The inhibitors are usually specific for either trypsin or chymotrypsin, and some are effective against both. They are thought to protect the seeds against consumption by animal predators, while at the same time existing as seed storage proteins themselves - all the actively inhibitory members contain 2 disulphide bridges. The existence of a member with no inhibitory activity, winged bean albumin 1, suggests that the inhibitors may have evolved from seed storage proteins. Proteins from the Kunitz family contain from 170 to 200 amino acid residues and one or two intra-chain disulphide bonds. The best conserved region is found in their N-terminal section. The crystal structures of soybean trypsin inhibitor (STI), trypsin inhibitor DE-3 from the Kaffir tree Erythrina caffra (ETI) [] and the bifunctional proteinase K/alpha-amylase inhibitor from wheat (PK13) have been solved, showing them to share the same 12-stranded beta-sheet structure as those of interleukin-1 and heparin-binding growth factors []. The beta-sheets are arranged in 3 similar lobes around a central axis, 6 strands forming an anti-parallel beta-barrel. Despite the structural similarity, STI shows no interleukin-1 bioactivity, presumably as a result of their primary sequence disparities. The active inhibitory site containing the scissile bond is located in the loop between beta-strands 4 and 5 in STI and ETI. The STIs belong to a superfamily that also contains the interleukin-1 proteins, heparin binding growth factors (HBGF) and histactophilin, all of which have very similar structures, but share no sequence similarity with the STI family.; GO: 0004866 endopeptidase inhibitor activity; PDB: 3TC2_B 3S8J_A 3S8K_A 1TIE_A 2GZB_A 3E8L_C 2IWT_B 3BX1_C 1AVA_D 3IIR_A ....
Probab=45.33  E-value=17  Score=30.76  Aligned_cols=20  Identities=20%  Similarity=0.366  Sum_probs=15.9

Q ss_pred             CccccccCCeEEEecCCccC
Q 048756           88 LEDELEADQIYFVLPTSKLQ  107 (218)
Q Consensus        88 ~DeeLqpGqiYFlLP~s~l~  107 (218)
                      .+++|++|.-||+||..+-.
T Consensus         6 ~G~~l~~g~~YyI~p~~~~~   25 (176)
T PF00197_consen    6 DGNPLRNGGEYYILPAIRGA   25 (176)
T ss_dssp             TSCB-BTTSEEEEEESSTGC
T ss_pred             CCCCCcCCCCEEEEeCccCC
Confidence            46789999999999987753


No 8  
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response. RelA contains a TGS domain, named after the Threonyl-tRNA Synthetase, GTPase, and SpoT proteins where it occurs.  The function of the TGS domain is unknown.
Probab=44.63  E-value=34  Score=22.51  Aligned_cols=25  Identities=28%  Similarity=0.220  Sum_probs=21.8

Q ss_pred             EEEccCCcEEEecCCccHHHHHHHH
Q 048756           32 KVLTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        32 KVV~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      -|..+||+..+|..++++.|++...
T Consensus         2 ~~~~~~g~~~~~~~~~t~~~~~~~~   26 (60)
T cd01668           2 YVFTPKGEIIELPAGATVLDFAYAI   26 (60)
T ss_pred             EEECCCCCEEEcCCCCCHHHHHHHH
Confidence            4677899999999999999998765


No 9  
>TIGR01323 nitrile_alph nitrile hydratase, alpha subunit. This model describes both iron- and cobalt-containing nitrile hydratase alpha chains. It excludes the thiocyanate hydrolase gamma subunit of Thiobacillus thioparus, a sequence that appears to have evolved from within the family of nitrile hydratase alpha subunits but which differs by several indels and a more rapid accumulation of point mutations.
Probab=44.47  E-value=23  Score=31.15  Aligned_cols=37  Identities=24%  Similarity=0.410  Sum_probs=27.8

Q ss_pred             CCCccccc-----cCCeEEEecCCccC-CCCCHHHHHHHHHHH
Q 048756           86 LDLEDELE-----ADQIYFVLPTSKLQ-YKLSASDMAALAVKA  122 (218)
Q Consensus        86 L~~DeeLq-----pGqiYFlLP~s~l~-~~LSa~dmAaLAvkA  122 (218)
                      |++|-+.+     +..+|||||+..-. ..||.+++++|.-+-
T Consensus       132 lP~~veVrV~Dstae~rYlVLP~RP~gte~lsEeqLa~lVtrd  174 (185)
T TIGR01323       132 LPSDVEIRVWDSSAESRYLVLPQRPAGTEHMSEEQLQQLVTRD  174 (185)
T ss_pred             CCCCeEEEEEeCCCCeEEEEEecCCCCCCCCCHHHHHHhhccc
Confidence            45555443     67899999998765 459999999987653


No 10 
>PF15386 Tantalus:  Drosophila Tantalus-like
Probab=40.13  E-value=9.4  Score=27.87  Aligned_cols=12  Identities=42%  Similarity=0.498  Sum_probs=9.6

Q ss_pred             cccee-eeeeeec
Q 048756          203 RSFRL-RLATIFE  214 (218)
Q Consensus       203 rs~~~-~l~ti~e  214 (218)
                      .++-. .|+||||
T Consensus        31 k~~~~~~LETIfE   43 (61)
T PF15386_consen   31 KKPTPKNLETIFE   43 (61)
T ss_pred             CCCCcCCcchhhc
Confidence            55666 8999998


No 11 
>PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional
Probab=37.35  E-value=1e+02  Score=28.65  Aligned_cols=84  Identities=15%  Similarity=0.212  Sum_probs=56.5

Q ss_pred             CCCceEEEccCCcEEEecCCccHHHHHHHHHhhhcCcCCCCCeEEEccCCCCCCCCCCCCCCcccc-ccCCeEEEecCCc
Q 048756           27 KHSTAKVLTLKGEVAEYKVPVIVSQVLAHQLAAQADQEEAPSWFLCSSDSLLFDDYIPALDLEDEL-EADQIYFVLPTSK  105 (218)
Q Consensus        27 ~~~taKVV~~DG~v~ef~~PvtAseVL~~~~~~~~~~~~~P~~FVC~SD~L~~~~~i~aL~~DeeL-qpGqiYFlLP~s~  105 (218)
                      .+..+-||.+|+.   ...|..|.|+|.+..        =|--+|.+.         |....+++| +-|.=|+++|.+.
T Consensus        60 ~pDf~i~isPN~a---~PGP~~ARE~l~~~~--------iP~IvI~D~---------p~~K~~d~l~~~g~GYIivk~Dp  119 (277)
T PRK00994         60 KPDFVIVISPNPA---APGPKKAREILKAAG--------IPCIVIGDA---------PGKKVKDAMEEQGLGYIIVKADP  119 (277)
T ss_pred             CCCEEEEECCCCC---CCCchHHHHHHHhcC--------CCEEEEcCC---------CccchHHHHHhcCCcEEEEecCc
Confidence            4567778888876   478999999999761        043333222         234344555 4577799999876


Q ss_pred             c----CCCCCHHHHHHHHHHHHHHHHhcc
Q 048756          106 L----QYKLSASDMAALAVKASLALQNAS  130 (218)
Q Consensus       106 l----~~~LSa~dmAaLAvkAssAL~~~~  130 (218)
                      .    +.-|.+.|||.+..-+-..|..++
T Consensus       120 MIGArREFLDP~EMa~fNaD~~kVLa~tG  148 (277)
T PRK00994        120 MIGARREFLDPVEMALFNADVLKVLAGTG  148 (277)
T ss_pred             cccchhhccCHHHHHHhhhhHHHHHHhhh
Confidence            4    233999999998877666665543


No 12 
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein. ThiS (ThiaminS) is a sulfur carrier protein involved in thiamin biosynthesis in bacteria.  The ThiS fold, like those of two closely related proteins MoaD and Urm1, is similar to that of ubiquitin although there is little or no sequence similarity.
Probab=35.52  E-value=51  Score=22.96  Aligned_cols=23  Identities=22%  Similarity=0.358  Sum_probs=21.1

Q ss_pred             EccCCcEEEecCCccHHHHHHHH
Q 048756           34 LTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        34 V~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      |..||+..++..+.++.++|...
T Consensus         2 i~iNg~~~~~~~~~tv~~ll~~l   24 (65)
T cd00565           2 ITVNGEPREVEEGATLAELLEEL   24 (65)
T ss_pred             EEECCeEEEcCCCCCHHHHHHHc
Confidence            56799999999999999999887


No 13 
>PRK07440 hypothetical protein; Provisional
Probab=35.24  E-value=38  Score=24.51  Aligned_cols=25  Identities=16%  Similarity=0.235  Sum_probs=22.4

Q ss_pred             EEEccCCcEEEecCCccHHHHHHHH
Q 048756           32 KVLTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        32 KVV~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      .-|..||+..++..+.++.|+|.+.
T Consensus         5 m~i~vNG~~~~~~~~~tl~~lL~~l   29 (70)
T PRK07440          5 ITLQVNGETRTCSSGTSLPDLLQQL   29 (70)
T ss_pred             eEEEECCEEEEcCCCCCHHHHHHHc
Confidence            4577899999999999999999876


No 14 
>PRK06944 sulfur carrier protein ThiS; Provisional
Probab=34.42  E-value=40  Score=23.18  Aligned_cols=23  Identities=17%  Similarity=0.163  Sum_probs=21.1

Q ss_pred             EccCCcEEEecCCccHHHHHHHH
Q 048756           34 LTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        34 V~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      |..||+..++....+++|++...
T Consensus         3 i~vNg~~~~~~~~~tl~~ll~~l   25 (65)
T PRK06944          3 IQLNQQTLSLPDGATVADALAAY   25 (65)
T ss_pred             EEECCEEEECCCCCcHHHHHHhh
Confidence            67899999999999999999877


No 15 
>PRK05863 sulfur carrier protein ThiS; Provisional
Probab=33.94  E-value=42  Score=23.70  Aligned_cols=23  Identities=17%  Similarity=0.206  Sum_probs=21.3

Q ss_pred             EccCCcEEEecCCccHHHHHHHH
Q 048756           34 LTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        34 V~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      |..||+..++..+.++.|+|.+.
T Consensus         3 i~vNG~~~~~~~~~tl~~ll~~l   25 (65)
T PRK05863          3 VVVNEEQVEVDEQTTVAALLDSL   25 (65)
T ss_pred             EEECCEEEEcCCCCcHHHHHHHc
Confidence            67899999999999999999987


No 16 
>PRK08053 sulfur carrier protein ThiS; Provisional
Probab=32.75  E-value=45  Score=23.48  Aligned_cols=23  Identities=9%  Similarity=0.163  Sum_probs=21.1

Q ss_pred             EccCCcEEEecCCccHHHHHHHH
Q 048756           34 LTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        34 V~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      |..||+..++..++++.|+|...
T Consensus         3 i~vNg~~~~~~~~~tl~~ll~~l   25 (66)
T PRK08053          3 ILFNDQPMQCAAGQTVHELLEQL   25 (66)
T ss_pred             EEECCeEEEcCCCCCHHHHHHHc
Confidence            67899999999999999999876


No 17 
>smart00452 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors.
Probab=31.87  E-value=30  Score=29.30  Aligned_cols=18  Identities=22%  Similarity=0.530  Sum_probs=15.9

Q ss_pred             CccccccCCeEEEecCCc
Q 048756           88 LEDELEADQIYFVLPTSK  105 (218)
Q Consensus        88 ~DeeLqpGqiYFlLP~s~  105 (218)
                      .+++|++|.-||+||..+
T Consensus         5 ~G~~l~~G~~YyI~p~~~   22 (172)
T smart00452        5 DGNPLRNGGTYYILPAIR   22 (172)
T ss_pred             CCCCCcCCCcEEEEEccc
Confidence            467899999999999975


No 18 
>PF02597 ThiS:  ThiS family;  InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer. ThiS is coded in the thiCEFSGH operon in Escherichia coli. This family of proteins have two conserved Glycines at the COOH terminus. Thiocarboxylate is formed at the last G in the activation process. Sulphur is transferred from ThiI to ThiS in a reaction catalysed by IscS []. MoaD, a protein involved in sulphur transfer during molybdopterin synthesis, is about the same length and shows limited sequence similarity to ThiS. Both have the conserved GG at the COOH end.; PDB: 1JW9_D 1JWB_D 1JWA_D 3BII_D 1NVI_D 1FMA_D 1FM0_D 2QIE_G 2Q5W_D 2K5P_A ....
Probab=26.66  E-value=12  Score=26.10  Aligned_cols=18  Identities=22%  Similarity=0.099  Sum_probs=13.7

Q ss_pred             cEEEecCCccHHHHHHHH
Q 048756           39 EVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        39 ~v~ef~~PvtAseVL~~~   56 (218)
                      ...++..+.|+.|++...
T Consensus        14 ~~~~~~~~~tv~~ll~~l   31 (77)
T PF02597_consen   14 EEIEVPEGSTVRDLLEAL   31 (77)
T ss_dssp             EEEEESSTSBHHHHHHHH
T ss_pred             eEEecCCCCcHHHHHHHH
Confidence            344556699999999886


No 19 
>PF08428 Rib:  Rib/alpha-like repeat;  InterPro: IPR012706 This entry represents a region of about 79 amino acids found tandemly repeated up to fourteen times within the proteins that contain it. The repeats lack cysteines and are highly conserved, even at the DNA level, within and between proteins []. Proteins containing these repeats include the Rib and alpha surface antigens of group B Streptococcus, Esp of Enterococcus faecalis (Streptococcus faecalis), and related proteins of Lactobacillus. Most members of this protein family also have the cell wall anchor motif, LPXTG, shared by many staphyloccal and streptococcal surface antigens. These repeats are thought to define protective epitopes and may play a role in generating phenotypic and genotypic variation [].
Probab=25.77  E-value=28  Score=24.92  Aligned_cols=23  Identities=35%  Similarity=0.421  Sum_probs=20.0

Q ss_pred             CCceEEEccCCcEEEecCCccHH
Q 048756           28 HSTAKVLTLKGEVAEYKVPVIVS   50 (218)
Q Consensus        28 ~~taKVV~~DG~v~ef~~PvtAs   50 (218)
                      ...++|.++||+..+...||+|.
T Consensus        42 ~~~V~VtypDgS~~~V~v~V~V~   64 (65)
T PF08428_consen   42 TGKVKVTYPDGSTDEVPVPVTVT   64 (65)
T ss_pred             EEEEEEEcCCCCEEEEEeEEEEe
Confidence            56799999999999999988764


No 20 
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]
Probab=25.67  E-value=22  Score=34.63  Aligned_cols=68  Identities=21%  Similarity=0.265  Sum_probs=45.6

Q ss_pred             CCceEEEccCCcEEEecCCccHHHHHHHHHhhhcCcCCCCCeEEEccCCCC-----CCCCCCCCCCccccccCCeEEEec
Q 048756           28 HSTAKVLTLKGEVAEYKVPVIVSQVLAHQLAAQADQEEAPSWFLCSSDSLL-----FDDYIPALDLEDELEADQIYFVLP  102 (218)
Q Consensus        28 ~~taKVV~~DG~v~ef~~PvtAseVL~~~~~~~~~~~~~P~~FVC~SD~L~-----~~~~i~aL~~DeeLqpGqiYFlLP  102 (218)
                      ....+|+.+||.+.+-...-.|--+|.++.+-+      -|-++|+.|.-.     |...+--| .|+.|+||+-|.|==
T Consensus       265 s~V~~Ivt~dg~~~~A~aG~aVtl~L~deidis------RGd~i~~~~~~~~~~~~f~A~vvWm-~~~pl~pGr~Y~lK~  337 (431)
T COG2895         265 SRVKRIVTFDGELAQASAGEAVTLVLADEIDIS------RGDLIVAADAPPAVADAFDADVVWM-DEEPLLPGRSYDLKI  337 (431)
T ss_pred             eeEEEEeccCCchhhccCCceEEEEEcceeecc------cCcEEEccCCCcchhhhcceeEEEe-cCCCCCCCceEEEEe
Confidence            456788899999998887766666666654332      577888877622     22222212 578899999998753


No 21 
>PRK06083 sulfur carrier protein ThiS; Provisional
Probab=25.03  E-value=68  Score=24.32  Aligned_cols=25  Identities=8%  Similarity=0.283  Sum_probs=22.5

Q ss_pred             EEEccCCcEEEecCCccHHHHHHHH
Q 048756           32 KVLTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        32 KVV~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      .-|..||+..+++.+.++.|+|...
T Consensus        19 m~I~VNG~~~~~~~~~tl~~LL~~l   43 (84)
T PRK06083         19 ITISINDQSIQVDISSSLAQIIAQL   43 (84)
T ss_pred             EEEEECCeEEEcCCCCcHHHHHHHc
Confidence            3478999999999999999999887


No 22 
>PRK06437 hypothetical protein; Provisional
Probab=25.00  E-value=1.9e+02  Score=20.61  Aligned_cols=52  Identities=8%  Similarity=0.238  Sum_probs=31.6

Q ss_pred             EccCC---cEEEecCCccHHHHHHHHHhhhcCcCCCCC-eEEEccCCCCCCCCCCCCCCccccccC-CeEEE
Q 048756           34 LTLKG---EVAEYKVPVIVSQVLAHQLAAQADQEEAPS-WFLCSSDSLLFDDYIPALDLEDELEAD-QIYFV  100 (218)
Q Consensus        34 V~~DG---~v~ef~~PvtAseVL~~~~~~~~~~~~~P~-~FVC~SD~L~~~~~i~aL~~DeeLqpG-qiYFl  100 (218)
                      |..||   ...++..+.+++|+|.+..-.       +. ..|..-     +.   .++.|..|+.| .|-++
T Consensus         5 ~~v~g~~~~~~~i~~~~tv~dLL~~Lgi~-------~~~vaV~vN-----g~---iv~~~~~L~dgD~Veiv   61 (67)
T PRK06437          5 IRVKGHINKTIEIDHELTVNDIIKDLGLD-------EEEYVVIVN-----GS---PVLEDHNVKKEDDVLIL   61 (67)
T ss_pred             EEecCCcceEEEcCCCCcHHHHHHHcCCC-------CccEEEEEC-----CE---ECCCceEcCCCCEEEEE
Confidence            45568   557788889999999987211       33 333211     11   23478888887 44443


No 23 
>PRK07696 sulfur carrier protein ThiS; Provisional
Probab=24.24  E-value=76  Score=22.63  Aligned_cols=23  Identities=26%  Similarity=0.407  Sum_probs=20.3

Q ss_pred             EccCCcEEEecCC-ccHHHHHHHH
Q 048756           34 LTLKGEVAEYKVP-VIVSQVLAHQ   56 (218)
Q Consensus        34 V~~DG~v~ef~~P-vtAseVL~~~   56 (218)
                      |..||+-.++..+ .++.|+|.+.
T Consensus         3 I~vNG~~~~~~~~~~tv~~lL~~l   26 (67)
T PRK07696          3 LKINGNQIEVPESVKTVAELLTHL   26 (67)
T ss_pred             EEECCEEEEcCCCcccHHHHHHHc
Confidence            6789999999987 6899999876


No 24 
>PF10857 DUF2701:  Protein of unknown function (DUF2701);  InterPro: IPR022586  This entry represents viral proteins with unknown function. The entry contains ORF C51 from Swinepox virus (strain Kasza). 
Probab=24.05  E-value=23  Score=26.17  Aligned_cols=16  Identities=38%  Similarity=0.677  Sum_probs=13.3

Q ss_pred             eeehhhccccccccceeeeeeee
Q 048756          191 QRYTSRRTKLAVRSFRLRLATIF  213 (218)
Q Consensus       191 ~r~~~~~~~~~~rs~~~~l~ti~  213 (218)
                      -..|+|      |||+ +|+++|
T Consensus        36 in~TtR------RsF~-~Ld~vY   51 (63)
T PF10857_consen   36 INATTR------RSFT-QLDNVY   51 (63)
T ss_pred             HHHHhH------hhHH-HhcCEE
Confidence            345888      9999 999998


No 25 
>PF01993 MTD:  methylene-5,6,7,8-tetrahydromethanopterin dehydrogenase;  InterPro: IPR002844 This archaeal enzyme family is involved in formation of methane from carbon dioxide 1.5.99.9 from EC. The enzyme requires coenzyme F420 [].; GO: 0008901 ferredoxin hydrogenase activity, 0015948 methanogenesis, 0055114 oxidation-reduction process; PDB: 1U6I_D 3IQF_G 1QV9_C 3IQE_F 1U6J_G 3IQZ_D 1U6K_B.
Probab=23.78  E-value=80  Score=29.30  Aligned_cols=83  Identities=16%  Similarity=0.209  Sum_probs=48.9

Q ss_pred             CCceEEEccCCcEEEecCCccHHHHHHHHHhhhcCcCCCCCeEEEccCCCCCCCCCCCCCCcccc-ccCCeEEEecCCcc
Q 048756           28 HSTAKVLTLKGEVAEYKVPVIVSQVLAHQLAAQADQEEAPSWFLCSSDSLLFDDYIPALDLEDEL-EADQIYFVLPTSKL  106 (218)
Q Consensus        28 ~~taKVV~~DG~v~ef~~PvtAseVL~~~~~~~~~~~~~P~~FVC~SD~L~~~~~i~aL~~DeeL-qpGqiYFlLP~s~l  106 (218)
                      +..+-||.+|+.   ...|..+.|++.+..        =|--+|.+.         |.....++| +-|.=|+++|.+..
T Consensus        60 pdf~I~isPN~~---~PGP~~ARE~l~~~~--------iP~IvI~D~---------p~~k~kd~l~~~g~GYIivk~DpM  119 (276)
T PF01993_consen   60 PDFVIVISPNAA---APGPTKAREMLSAKG--------IPCIVISDA---------PTKKAKDALEEEGFGYIIVKADPM  119 (276)
T ss_dssp             -SEEEEE-S-TT---SHHHHHHHHHHHHSS--------S-EEEEEEG---------GGGGGHHHHHHTT-EEEEETTS--
T ss_pred             CCEEEEECCCCC---CCCcHHHHHHHHhCC--------CCEEEEcCC---------CchhhHHHHHhcCCcEEEEecCcc
Confidence            456777778875   367889999996651        054444332         223333444 45777999998865


Q ss_pred             ----CCCCCHHHHHHHHHHHHHHHHhcc
Q 048756          107 ----QYKLSASDMAALAVKASLALQNAS  130 (218)
Q Consensus       107 ----~~~LSa~dmAaLAvkAssAL~~~~  130 (218)
                          +.-|.+.|||.+..-+-..|..++
T Consensus       120 IGArREFLDP~EMa~fNaD~~kVLa~tG  147 (276)
T PF01993_consen  120 IGARREFLDPVEMALFNADVLKVLAITG  147 (276)
T ss_dssp             ----TTT--HHHHHHHHHHHHHHHHHTT
T ss_pred             ccccccccCHHHHHHhhhhHHHHHHhhh
Confidence                233999999999887777776654


No 26 
>cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin. TGS is a small domain of about 50 amino acid residues with a predominantly beta-sheet structure. There is no direct information on the function of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role.
Probab=22.36  E-value=1.5e+02  Score=18.33  Aligned_cols=25  Identities=12%  Similarity=0.081  Sum_probs=21.4

Q ss_pred             EEEccCCcEEEecCCccHHHHHHHH
Q 048756           32 KVLTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        32 KVV~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      .++..||...++....++.+++.+.
T Consensus         2 ~~~~~~~~~~~~~~g~t~~~~~~~~   26 (60)
T cd01616           2 IIFTPDGSAVELPKGATAMDFALKI   26 (60)
T ss_pred             EEECCCCCEEEcCCCCCHHHHHHHH
Confidence            4677889999999999999988776


No 27 
>cd01667 TGS_ThrRS_N TGS _ThrRS_N:  ThrRS (threonyl-tRNA Synthetase)  is a class II tRNA synthetase that couples threonine to its cognate tRNA.  In addition to its catalytic and anticodon-binding domains, ThrRS has an N-terminal TGS domain, named after the ThrRS, GTPase, and SpoT proteins where it occurs. The TGS domain is thought to interact with the tRNA acceptor arm along with an adjacent N-terminal domain. The specific function of TGS is not well understood.
Probab=22.18  E-value=1.6e+02  Score=18.45  Aligned_cols=25  Identities=16%  Similarity=0.166  Sum_probs=21.5

Q ss_pred             EEEccCCcEEEecCCccHHHHHHHH
Q 048756           32 KVLTLKGEVAEYKVPVIVSQVLAHQ   56 (218)
Q Consensus        32 KVV~~DG~v~ef~~PvtAseVL~~~   56 (218)
                      ++...||...++..+++..+++.+.
T Consensus         2 ~i~~~~~~~~~~~~~~t~~~~~~~~   26 (61)
T cd01667           2 KITLPDGSVKEFPKGTTPLDIAKSI   26 (61)
T ss_pred             EEEcCCCCEEEeCCCCCHHHHHHHH
Confidence            5667789999999999999988876


No 28 
>PF02079 TP1:  Nuclear transition protein 1;  InterPro: IPR001319 Nuclear transition protein 1 (TP1) is one of the spermatid-specific proteins []. TP1 is a basic protein well conserved in mammalian species. In mammals, the second stage of spermatogenesis is characterised by the conversion of nucleosomal chromatin to the compact, non-nucleosomal and transcriptionally inactive form found in the sperm nucleus. This condensation is associated with a double-protein transition. The first transition corresponds to the replacement of histones by several spermatid-specific proteins (also called transition proteins) which are themselves replaced by protamines during the second transition.; GO: 0003677 DNA binding, 0007283 spermatogenesis, 0000786 nucleosome, 0005634 nucleus
Probab=20.82  E-value=47  Score=23.59  Aligned_cols=32  Identities=28%  Similarity=0.488  Sum_probs=23.2

Q ss_pred             ccccCcccccccccceee---hhhcccccccccee
Q 048756          176 RANFGISRSASVRKFQRY---TSRRTKLAVRSFRL  207 (218)
Q Consensus       176 ~~~~g~~~~~~~~~~~r~---~~~~~~~~~rs~~~  207 (218)
                      .++.|+.|.|+-||.++-   +..|-.-|-|.||-
T Consensus        18 ~phkgvkrggskrkyrk~~lksrkr~ddanrn~rs   52 (54)
T PF02079_consen   18 SPHKGVKRGGSKRKYRKSSLKSRKRGDDANRNYRS   52 (54)
T ss_pred             CCccccccccccchhhhccccccccccccccchhc
Confidence            457999999999998874   23455566677763


No 29 
>PF05833 FbpA:  Fibronectin-binding protein A N-terminus (FbpA);  InterPro: IPR008616 This family consists of the N-terminal region of the prokaryotic fibronectin-binding protein, the C-terminal region is IPR008532 from INTERPRO. Fibronectin binding is considered to be an important virulence factor in streptococcal infections. Fibronectin is a dimeric glycoprotein that is present in a soluble form in plasma and extracellular fluids; it is also present in a fibrillar form on cell surfaces. Both the soluble and cellular forms of fibronectin may be incorporated into the extracellular tissue matrix. While fibronectin has critical roles in eukaryotic cellular processes, such as adhesion, migration and differentiation, it is also a substrate for the attachment of bacteria. The binding of pathogenic Streptococcus pyogenes and Staphylococcus aureus to epithelial cells via fibronectin facilitates their internalisation and systemic spread within the host [].; PDB: 3DOA_A 2ZBK_F 2HKJ_A 1Z5B_A 1Z5C_B 1MX0_F 1Z5A_A 1MU5_A 1Z59_A.
Probab=20.29  E-value=67  Score=30.24  Aligned_cols=57  Identities=12%  Similarity=0.255  Sum_probs=22.9

Q ss_pred             cHHHHHHHHHhhhcCcCCCCCeEEEccCCCCCCC--CCCC-CCCccccccCCeEEEecCCccCCCCCHHH
Q 048756           48 IVSQVLAHQLAAQADQEEAPSWFLCSSDSLLFDD--YIPA-LDLEDELEADQIYFVLPTSKLQYKLSASD  114 (218)
Q Consensus        48 tAseVL~~~~~~~~~~~~~P~~FVC~SD~L~~~~--~i~a-L~~DeeLqpGqiYFlLP~s~l~~~LSa~d  114 (218)
                      -+-|+|..+          .+-+||+.+.--++.  ++.. ...|-++.||..|..-|......+++.++
T Consensus       115 Li~El~g~~----------~NiiL~d~~~~Il~a~~~~~~~~~~~R~i~~G~~Y~~Pp~~~~~~p~~~~~  174 (455)
T PF05833_consen  115 LIIELMGRH----------SNIILTDEDGKILDALRRVSFSQSRDREILPGEPYIPPPPQDKLDPLDLEE  174 (455)
T ss_dssp             EEEE--GGG-----------EEEEEETT-BEEEESS-B---------BSTTSB---------B-CCC--H
T ss_pred             EEEEEcCCc----------ccEEEEcCCCeEEeehhhcCcccccceeeccCccccccccccCCCcccchh
Confidence            477899998          789999887632222  2221 34478999999999777755555655444


No 30 
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]
Probab=20.16  E-value=35  Score=31.97  Aligned_cols=22  Identities=27%  Similarity=0.416  Sum_probs=20.2

Q ss_pred             hhccccccccceeeeeeeeccc
Q 048756          195 SRRTKLAVRSFRLRLATIFEGI  216 (218)
Q Consensus       195 ~~~~~~~~rs~~~~l~ti~e~~  216 (218)
                      .-|++||.++++..+.+|-||.
T Consensus        47 ~~raylAlg~~~~~~~eI~~~~   68 (299)
T KOG3081|consen   47 MYRAYLALGQYQIVISEIKEGK   68 (299)
T ss_pred             HHHHHHHccccccccccccccc
Confidence            4599999999999999999986


Done!