Citrus Sinensis ID: 048770

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MESRNREKKRKRREILEKKKAIDESLKAASAHKDHLTAFPSFRQYERNGLSVHLESGCGDKLSSAEKQYILNLLKANMEGPYGSEWPAEEKVKRREMVASEARYIFARELDAPSASASEMSKTNFAESKGSIVGFVHFRFCLEEDVPVLYVYELQLESRVQGKGLGKFLMQLIELIARKNRMGAVVLTVQKANLLAMNFYLSKLRYVVSSISPSRVDPFTGVEKSYEILCKVFDNESKALLQE
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccEEEEEEEccccccccccccccccccccccEEEEEEEEEEEcccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHcccEEcccccccccccccccccEEEEEccccccHHHHHcc
*************************LKAASAHKDHLTAFPSFRQYERNGLSVHLESGCGDKLSSAEKQYILNLLKANMEGPYGSEWPAEEKVKRREMVASEARYIFARELDA***********NFAESKGSIVGFVHFRFCLEEDVPVLYVYELQLESRVQGKGLGKFLMQLIELIARKNRMGAVVLTVQKANLLAMNFYLSKLRYVVSSISPSRVDPFTGVEKSYEILCKVFD*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESRNREKKRKRREILEKKKAIDESLKAASAHKDHLTAFPSFRQYERNGLSVHLESGCGDKLSSAEKQYILNLLKANMEGPYGSEWPAEEKVKRREMVASEARYIFARELDAPSASASEMSKTNFAESKGSIVGFVHFRFCLEEDVPVLYVYELQLESRVQGKGLGKFLMQLIELIARKNRMGAVVLTVQKANLLAMNFYLSKLRYVVSSISPSRVDPFTGVEKSYEILCKVFDNESKALLQE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-alpha-acetyltransferase 40 probableQ86UY6
N-alpha-acetyltransferase 40 probableQ8VE10
N-alpha-acetyltransferase 40 probableQ568K5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GHE, chain A
Confidence level:very confident
Coverage over the Query: 123-233
View the alignment between query and template
View the model in PyMOL
Template: 1TIQ, chain A
Confidence level:confident
Coverage over the Query: 62-102,122-236
View the alignment between query and template
View the model in PyMOL
Template: 1RO5, chain A
Confidence level:confident
Coverage over the Query: 53-109,129-240
View the alignment between query and template
View the model in PyMOL