BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048812
         (645 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2KCL|A Chain A, Solution Nmr Structure Of Tetratricopeptide Repeat Domain
           Protein Sru_0103 From Salinibacter Ruber, Northeast
           Structural Genomics Consortium (Nesg) Target Srr115c
 pdb|2KCV|A Chain A, Solution Nmr Structure Of Tetratricopeptide Repeat Domain
           Protein Sru_0103 From Salinibacter Ruber, Northeast
           Structural Genomics Consortium (Nesg) Target Srr115c
          Length = 99

 Score = 30.0 bits (66), Expect = 3.7,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 19/40 (47%)

Query: 471 HQNVKLAEHAFKHLTETDPLNDGAHVLLANIYAKAGRLDD 510
           H N   A   F+ L ETDP   G +  L  +Y +  R DD
Sbjct: 19  HDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDD 58


>pdb|3MA5|A Chain A, Crystal Structure Of The Tetratricopeptide Repeat Domain
           Protein Q2s6c5_salrd From Salinibacter Ruber. Northeast
           Structural Genomics Consortium Target Srr115c.
 pdb|3MA5|B Chain B, Crystal Structure Of The Tetratricopeptide Repeat Domain
           Protein Q2s6c5_salrd From Salinibacter Ruber. Northeast
           Structural Genomics Consortium Target Srr115c.
 pdb|3MA5|C Chain C, Crystal Structure Of The Tetratricopeptide Repeat Domain
           Protein Q2s6c5_salrd From Salinibacter Ruber. Northeast
           Structural Genomics Consortium Target Srr115c.
 pdb|3MA5|D Chain D, Crystal Structure Of The Tetratricopeptide Repeat Domain
           Protein Q2s6c5_salrd From Salinibacter Ruber. Northeast
           Structural Genomics Consortium Target Srr115c
          Length = 100

 Score = 30.0 bits (66), Expect = 3.9,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 19/40 (47%)

Query: 471 HQNVKLAEHAFKHLTETDPLNDGAHVLLANIYAKAGRLDD 510
           H N   A   F+ L ETDP   G +  L  +Y +  R DD
Sbjct: 20  HDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDD 59


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.408 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,532,482
Number of Sequences: 62578
Number of extensions: 750984
Number of successful extensions: 1689
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1683
Number of HSP's gapped (non-prelim): 9
length of query: 645
length of database: 14,973,337
effective HSP length: 105
effective length of query: 540
effective length of database: 8,402,647
effective search space: 4537429380
effective search space used: 4537429380
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)