BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 048825
         (171 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3TLM|A Chain A, Crystal Structure Of Endoplasmic Reticulum Ca2+-Atpase
           (Serca) From Bovine Muscle
          Length = 992

 Score = 29.6 bits (65), Expect = 0.78,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 17/31 (54%)

Query: 2   DTLGALALATEQPTNDLMSKPPVGRSEPLIT 32
           D L A AL    P  D+M +PP    EPLI+
Sbjct: 799 DGLPATALGFNPPDLDIMDRPPRTPKEPLIS 829


>pdb|3BA6|A Chain A, Structure Of The Ca2e1p Phosphoenzyme Intermediate Of The
           Serca Ca2+-Atpase
          Length = 994

 Score = 29.6 bits (65), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 17/31 (54%)

Query: 2   DTLGALALATEQPTNDLMSKPPVGRSEPLIT 32
           D L A AL    P  D+M +PP    EPLI+
Sbjct: 800 DGLPATALGFNPPDLDIMDRPPRSPKEPLIS 830


>pdb|2DQS|A Chain A, Crystal Structure Of The Calcium Pump With Amppcp In The
           Absence Of Calcium
 pdb|2EAR|A Chain A, P21 Crystal Of The Sr Ca2+-Atpase With Bound Tg
 pdb|2EAT|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Bound Cpa And
           Tg
 pdb|2ZBF|A Chain A, Calcium Pump Crystal Structure With Bound Bef3 And Tg In
           The Absence Of Calcium
 pdb|2ZBG|A Chain A, Calcium Pump Crystal Structure With Bound Alf4 And Tg In
           The Absence Of Calcium
 pdb|3AR2|A Chain A, Calcium Pump Crystal Structure With Bound Amppcp And Ca2+
 pdb|3AR3|A Chain A, Calcium Pump Crystal Structure With Bound Adp And Tg
 pdb|3AR4|A Chain A, Calcium Pump Crystal Structure With Bound Atp And Tg In
           The Absence Of Ca2+
 pdb|3AR5|A Chain A, Calcium Pump Crystal Structure With Bound Tnp-Amp And Tg
 pdb|3AR6|A Chain A, Calcium Pump Crystal Structure With Bound Tnp-Adp And Tg
           In The Absence Of Calcium
 pdb|3AR7|A Chain A, Calcium Pump Crystal Structure With Bound Tnp-Atp And Tg
           In The Absence Of Ca2+
 pdb|3AR8|A Chain A, Calcium Pump Crystal Structure With Bound Alf4, Tnp-Amp
           And Tg
 pdb|3AR9|A Chain A, Calcium Pump Crystal Structure With Bound Bef3, Tnp-Amp
           And Tg In The Absence Of Calcium
 pdb|2ZBE|A Chain A, Calcium Pump Crystal Structure With Bound Bef3 In The
           Absence Of Calcium And Tg
 pdb|2ZBE|B Chain B, Calcium Pump Crystal Structure With Bound Bef3 In The
           Absence Of Calcium And Tg
 pdb|2ZBD|A Chain A, Crystal Structure Of The Sr Calcium Pump With Bound
           Aluminium Fluoride, Adp And Calcium
          Length = 995

 Score = 29.6 bits (65), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 17/31 (54%)

Query: 2   DTLGALALATEQPTNDLMSKPPVGRSEPLIT 32
           D L A AL    P  D+M +PP    EPLI+
Sbjct: 801 DGLPATALGFNPPDLDIMDRPPRSPKEPLIS 831


>pdb|1KJU|A Chain A, Ca2+-Atpase In The E2 State
 pdb|1IWO|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase In The Absence Of
           Ca2+
 pdb|1IWO|B Chain B, Crystal Structure Of The Sr Ca2+-Atpase In The Absence Of
           Ca2+
 pdb|1SU4|A Chain A, Crystal Structure Of Calcium Atpase With Two Bound Calcium
           Ions
 pdb|1T5S|A Chain A, Structure Of The (sr)ca2+-atpase Ca2-e1-amppcp Form
 pdb|1T5T|A Chain A, Structure Of The (Sr)ca2+-Atpase Ca2-E1-Adp:alf4- Form
 pdb|1VFP|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Bound Amppcp
 pdb|1VFP|B Chain B, Crystal Structure Of The Sr Ca2+-Atpase With Bound Amppcp
 pdb|1WPG|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Mgf4
 pdb|1WPG|B Chain B, Crystal Structure Of The Sr Ca2+-Atpase With Mgf4
 pdb|1WPG|C Chain C, Crystal Structure Of The Sr Ca2+-Atpase With Mgf4
 pdb|1WPG|D Chain D, Crystal Structure Of The Sr Ca2+-Atpase With Mgf4
 pdb|1XP5|A Chain A, Structure Of The (Sr)ca2+-Atpase E2-Alf4- Form
 pdb|2AGV|A Chain A, Crystal Structure Of The Sr Ca2+-atpase With Bhq And Tg
 pdb|2AGV|B Chain B, Crystal Structure Of The Sr Ca2+-atpase With Bhq And Tg
 pdb|2BY4|A Chain A, Sr Ca(2+)-Atpase In The Hne2 State Complexed With The
           Thapsigargin Derivative Boc-12adt.
 pdb|2C88|A Chain A, Crystal Structure Of (Sr) Calcium-Atpase E2(Tg):amppcp
           Form
 pdb|2C8K|A Chain A, Crystal Structure Of (Sr) Calcium-Atpase E2(Tg) With
           Partially Occupied Amppcp Site
 pdb|2C8L|A Chain A, Crystal Structure Of (Sr) Calcium-Atpase E2(Tg) Form
 pdb|2C9M|A Chain A, Structure Of (Sr) Calcium-Atpase In The Ca2e1 State Solved
           In A P1 Crystal Form.
 pdb|2C9M|B Chain B, Structure Of (Sr) Calcium-Atpase In The Ca2e1 State Solved
           In A P1 Crystal Form.
 pdb|2O9J|A Chain A, Crystal Structure Of Calcium Atpase With Bound Magnesium
           Fluoride And Cyclopiazonic Acid
 pdb|2OA0|A Chain A, Crystal Structure Of Calcium Atpase With Bound Adp And
           Cyclopiazonic Acid
 pdb|3B9B|A Chain A, Structure Of The E2 Beryllium Fluoride Complex Of The
           Serca Ca2+-Atpase
 pdb|3B9R|A Chain A, Serca Ca2+-Atpase E2 Aluminium Fluoride Complex Without
           Thapsigargin
 pdb|3B9R|B Chain B, Serca Ca2+-Atpase E2 Aluminium Fluoride Complex Without
           Thapsigargin
 pdb|2EAS|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Bound Cpa
 pdb|2EAU|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Bound Cpa In
           The Presence Of Curcumin
 pdb|3FGO|A Chain A, Crystal Structure Of The E2 Magnesium Fluoride Complex Of
           The (Sr) Ca2+-Atpase With Bound Cpa And Amppcp
 pdb|3FGO|B Chain B, Crystal Structure Of The E2 Magnesium Fluoride Complex Of
           The (Sr) Ca2+-Atpase With Bound Cpa And Amppcp
 pdb|3FPB|A Chain A, The Structure Of Sarcoplasmic Reticulum Ca2+-Atpase Bound
           To Cyclopiazonic Acid With Atp
 pdb|3FPS|A Chain A, The Structure Of Sarcoplasmic Reticulum Ca2+-Atpase Bound
           To Cyclopiazonic And Adp
 pdb|3NAL|A Chain A, Sr Ca(2+)-Atpase In The Hne2 State Complexed With The
           Thapsigargin Derivative Dtb
 pdb|3NAM|A Chain A, Sr Ca(2+)-Atpase In The Hne2 State Complexed With The
           Thapsigargin Derivative Dotg
 pdb|3NAN|A Chain A, Sr Ca(2+)-Atpase In The Hne2 State Complexed With A
           Thapsigargin Derivative Boc-(Phi)tg
 pdb|3N5K|A Chain A, Structure Of The (sr)ca2+-atpase E2-alf4- Form
 pdb|3N5K|B Chain B, Structure Of The (sr)ca2+-atpase E2-alf4- Form
 pdb|3N8G|A Chain A, Structure Of The (sr)ca2+-atpase Ca2-e1-caamppcp Form
 pdb|2YFY|A Chain A, Serca In The Hne2 State Complexed With Debutanoyl
           Thapsigargin
          Length = 994

 Score = 29.6 bits (65), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 17/31 (54%)

Query: 2   DTLGALALATEQPTNDLMSKPPVGRSEPLIT 32
           D L A AL    P  D+M +PP    EPLI+
Sbjct: 800 DGLPATALGFNPPDLDIMDRPPRSPKEPLIS 830


>pdb|2HPA|A Chain A, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|2HPA|B Chain B, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|2HPA|C Chain C, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|2HPA|D Chain D, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|1CVI|A Chain A, Crystal Structure Of Human Prostatic Acid Phosphatase
 pdb|1CVI|B Chain B, Crystal Structure Of Human Prostatic Acid Phosphatase
 pdb|1CVI|C Chain C, Crystal Structure Of Human Prostatic Acid Phosphatase
 pdb|1CVI|D Chain D, Crystal Structure Of Human Prostatic Acid Phosphatase
          Length = 342

 Score = 28.9 bits (63), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 68  KDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIG 110
           +D +++  F  C  F E  +  L+ +   K +H  K F+A +G
Sbjct: 118 EDQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLG 160


>pdb|1ND5|A Chain A, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND5|B Chain B, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND5|C Chain C, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND5|D Chain D, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|A Chain A, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|B Chain B, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|C Chain C, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|D Chain D, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
          Length = 354

 Score = 28.9 bits (63), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 68  KDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIG 110
           +D +++  F  C  F E  +  L+ +   K +H  K F+A +G
Sbjct: 118 EDQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLG 160


>pdb|1HXD|A Chain A, Crystal Structure Of E. Coli Biotin Repressor With Bound
           Biotin
 pdb|1HXD|B Chain B, Crystal Structure Of E. Coli Biotin Repressor With Bound
           Biotin
 pdb|2EWN|A Chain A, Ecoli Biotin Repressor With Co-repressor Analog
 pdb|2EWN|B Chain B, Ecoli Biotin Repressor With Co-repressor Analog
 pdb|1BIA|A Chain A, The E. Coli Biotin Holoenzyme Synthetase(Slash)bio
           Repressor Crystal Structure Delineates The Biotin And
           Dna- Binding Domains
 pdb|1BIB|A Chain A, The E. Coli Biotin Holoenzyme Synthetase(Slash)bio
           Repressor Crystal Structure Delineates The Biotin And
           Dna- Binding Domains
          Length = 321

 Score = 27.7 bits (60), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 107 AIIGITIVLQLIMVEFLKKF-ADTERLNW 134
           A IG+++V+ ++M E L+K  AD  R+ W
Sbjct: 145 AAIGLSLVIGIVMAEVLRKLGADKVRVKW 173


>pdb|3H70|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid Synthetase
           From Staphylococcus Aureus Complexed With Mg In The
           Active Site
          Length = 343

 Score = 26.2 bits (56), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 27  SEPLITKLMWRNLIPQAIYQVTILLTLQFKGRSIFSVNESV 67
           ++P   KL W    PQ ++Q+ +L  L F  + +   NES+
Sbjct: 141 TKPTRIKLKW---TPQIMHQIRVLRELDFHFQLVIDANESL 178


>pdb|2OKT|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid Synthetase
           From Staphylococcus Aureus, Ligand-Free Form
 pdb|2OLA|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid Synthetase
           From Staphylococcus Aureus, Cubic Crystal Form
          Length = 342

 Score = 26.2 bits (56), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 27  SEPLITKLMWRNLIPQAIYQVTILLTLQFKGRSIFSVNESV 67
           ++P   KL W    PQ ++Q+ +L  L F  + +   NES+
Sbjct: 140 TKPTRIKLKW---TPQIMHQIRVLRELDFHFQLVIDANESL 177


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.140    0.426 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,539,286
Number of Sequences: 62578
Number of extensions: 160099
Number of successful extensions: 395
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 385
Number of HSP's gapped (non-prelim): 19
length of query: 171
length of database: 14,973,337
effective HSP length: 92
effective length of query: 79
effective length of database: 9,216,161
effective search space: 728076719
effective search space used: 728076719
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)