Query         psy10
Match_columns 100
No_of_seqs    138 out of 1183
Neff          8.6 
Searched_HMMs 46136
Date          Fri Aug 16 15:15:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0694|consensus               99.8 1.9E-21 4.1E-26  146.1   2.8   81    1-86    599-692 (694)
  2 KOG0986|consensus               99.8 1.6E-20 3.4E-25  136.8   2.8   88    2-91    426-514 (591)
  3 KOG0598|consensus               99.7 1.6E-17 3.6E-22  117.8   2.4   81    1-86    257-356 (357)
  4 KOG0696|consensus               99.7 2.1E-17 4.7E-22  120.1   2.8   81    4-89    584-677 (683)
  5 KOG0690|consensus               99.6 2.2E-16 4.7E-21  112.2   3.1   79    3-86    401-496 (516)
  6 KOG0605|consensus               99.6 4.5E-16 9.7E-21  114.9   2.2   54    2-63    424-479 (550)
  7 KOG0695|consensus               99.6 6.5E-16 1.4E-20  110.4   2.7   80    4-88    493-586 (593)
  8 KOG0616|consensus               99.5   4E-15 8.7E-20  104.1   2.9   77    1-81    276-355 (355)
  9 KOG0612|consensus               99.3   1E-12 2.2E-17  103.9   4.5   71    8-85    322-404 (1317)
 10 KOG0610|consensus               99.3 1.2E-12 2.6E-17   94.9   3.3   45    1-47    368-415 (459)
 11 smart00133 S_TK_X Extension to  99.1 3.7E-11   8E-16   66.3   3.3   54   26-84      1-63  (64)
 12 KOG0614|consensus               99.1 3.4E-11 7.3E-16   89.7   1.9   51    8-63    659-713 (732)
 13 cd05617 STKc_aPKC_zeta Catalyt  99.1 1.5E-10 3.2E-15   81.5   4.2   79    1-84    234-326 (327)
 14 cd05590 STKc_nPKC_eta Catalyti  99.0 1.9E-10 4.1E-15   80.8   3.6   79    2-85    228-320 (320)
 15 cd05570 STKc_PKC Catalytic dom  99.0 2.5E-10 5.4E-15   80.0   3.8   79    1-84    227-318 (318)
 16 cd05619 STKc_nPKC_theta Cataly  99.0 2.8E-10   6E-15   79.9   3.9   80    2-86    228-316 (316)
 17 KOG0608|consensus               99.0 2.7E-10 5.9E-15   86.9   3.4   53    5-64    909-963 (1034)
 18 cd05592 STKc_nPKC_theta_delta   99.0 4.4E-10 9.5E-15   78.8   4.1   81    1-86    227-316 (316)
 19 cd05589 STKc_PKN Catalytic dom  99.0 3.8E-10 8.2E-15   79.2   3.8   78    2-84    233-324 (324)
 20 KOG0603|consensus               99.0 2.3E-10   5E-15   86.3   2.5   84    3-91    220-314 (612)
 21 cd05620 STKc_nPKC_delta Cataly  98.9 1.2E-09 2.5E-14   76.7   3.9   81    1-86    227-316 (316)
 22 cd05588 STKc_aPKC Catalytic do  98.9 1.4E-09   3E-14   76.7   4.0   79    1-84    236-328 (329)
 23 cd05571 STKc_PKB Catalytic dom  98.9 1.8E-09 3.9E-14   75.8   3.7   79    2-85    227-322 (323)
 24 PTZ00426 cAMP-dependent protei  98.9   2E-09 4.4E-14   76.5   3.7   75    2-81    260-340 (340)
 25 cd05618 STKc_aPKC_iota Catalyt  98.8 3.3E-09 7.1E-14   74.8   4.3   79    1-84    236-328 (329)
 26 cd05587 STKc_cPKC Catalytic do  98.8 2.6E-09 5.5E-14   75.0   3.6   78    2-84    233-323 (324)
 27 cd05591 STKc_nPKC_epsilon Cata  98.8 3.3E-09 7.2E-14   74.3   3.9   78    2-84    228-320 (321)
 28 cd05616 STKc_cPKC_beta Catalyt  98.8 5.8E-09 1.3E-13   73.2   5.1   77    2-84    233-322 (323)
 29 cd05586 STKc_Sck1_like Catalyt  98.8 4.2E-09 9.1E-14   74.0   4.2   56    2-62    230-288 (330)
 30 cd05585 STKc_YPK1_like Catalyt  98.8 7.5E-09 1.6E-13   72.3   4.1   78    1-83    224-312 (312)
 31 cd05615 STKc_cPKC_alpha Cataly  98.8 1.6E-08 3.5E-13   71.1   5.6   77    2-84    233-322 (323)
 32 cd05593 STKc_PKB_gamma Catalyt  98.7 8.4E-09 1.8E-13   72.7   3.7   79    2-85    227-324 (328)
 33 cd05614 STKc_MSK2_N N-terminal  98.7 9.8E-09 2.1E-13   72.1   4.0   79    2-85    243-331 (332)
 34 cd05604 STKc_SGK3 Catalytic do  98.7 1.1E-08 2.4E-13   71.9   4.0   80    2-86    228-325 (325)
 35 PTZ00263 protein kinase A cata  98.7 1.4E-08   3E-13   71.6   3.7   75    2-81    247-329 (329)
 36 cd05575 STKc_SGK Catalytic dom  98.6 2.8E-08   6E-13   69.7   3.5   78    2-84    228-323 (323)
 37 cd05631 STKc_GRK4 Catalytic do  98.6   1E-08 2.2E-13   70.7   0.9   44    2-45    237-284 (285)
 38 cd05584 STKc_p70S6K Catalytic   98.5   2E-07 4.3E-12   65.5   5.6   80    2-86    232-323 (323)
 39 cd05602 STKc_SGK1 Catalytic do  98.5 8.8E-08 1.9E-12   67.3   3.8   56    2-62    228-286 (325)
 40 cd05573 STKc_ROCK_NDR_like Cat  98.5 8.1E-08 1.7E-12   67.7   3.6   75    2-84    266-350 (350)
 41 cd05595 STKc_PKB_beta Catalyti  98.5 9.2E-08   2E-12   67.2   3.7   79    2-85    227-322 (323)
 42 cd05582 STKc_RSK_N N-terminal   98.5   1E-07 2.3E-12   66.6   3.4   79    1-84    229-318 (318)
 43 cd05612 STKc_PRKX_like Catalyt  98.5 7.4E-08 1.6E-12   66.6   2.5   57    1-62    229-289 (291)
 44 KOG0592|consensus               98.5 5.2E-08 1.1E-12   73.1   1.1   42    1-44    318-359 (604)
 45 cd05603 STKc_SGK2 Catalytic do  98.3 8.8E-07 1.9E-11   62.0   4.0   58    2-64    228-288 (321)
 46 cd05594 STKc_PKB_alpha Catalyt  98.3 7.3E-07 1.6E-11   62.6   3.5   59    2-65    228-290 (325)
 47 cd05599 STKc_NDR_like Catalyti  98.3 7.4E-07 1.6E-11   63.4   3.5   74    3-84    276-361 (364)
 48 cd05625 STKc_LATS1 Catalytic d  98.3 1.1E-06 2.4E-11   63.0   4.2   52    5-62    286-339 (382)
 49 cd05630 STKc_GRK6 Catalytic do  98.3 2.7E-07 5.8E-12   63.7   0.9   44    2-45    237-284 (285)
 50 cd05596 STKc_ROCK Catalytic do  98.2 1.2E-06 2.5E-11   63.0   3.7   77    2-84    283-369 (370)
 51 cd05605 STKc_GRK4_like Catalyt  98.2 4.5E-07 9.7E-12   62.5   1.5   44    2-45    237-284 (285)
 52 cd05607 STKc_GRK7 Catalytic do  98.2 4.3E-07 9.3E-12   62.3   1.4   45    1-45    230-277 (277)
 53 cd05627 STKc_NDR2 Catalytic do  98.2 1.4E-06   3E-11   62.1   3.8   49    7-62    276-326 (360)
 54 cd05608 STKc_GRK1 Catalytic do  98.2 4.1E-07 8.8E-12   62.5   0.9   43    2-44    233-279 (280)
 55 cd05628 STKc_NDR1 Catalytic do  98.2 1.7E-06 3.7E-11   61.7   4.1   48    8-62    277-326 (363)
 56 cd05626 STKc_LATS2 Catalytic d  98.2 2.1E-06 4.5E-11   61.7   3.7   43   14-62    297-339 (381)
 57 cd05629 STKc_NDR_like_fungal C  98.1 2.1E-06 4.7E-11   61.4   3.5   52    3-62    285-338 (377)
 58 cd05580 STKc_PKA Catalytic dom  98.1 1.6E-06 3.4E-11   59.8   2.5   55    2-61    230-288 (290)
 59 cd05601 STKc_CRIK Catalytic do  98.1 2.6E-06 5.7E-11   59.8   3.5   52    2-62    245-296 (330)
 60 cd05621 STKc_ROCK2 Catalytic d  98.1 4.4E-06 9.5E-11   60.1   3.7   66   14-84    296-369 (370)
 61 cd05583 STKc_MSK_N N-terminal   98.1 1.5E-06 3.3E-11   59.6   1.2   43    2-44    244-288 (288)
 62 cd05633 STKc_GRK3 Catalytic do  98.0   3E-06 6.4E-11   58.3   1.5   44    2-45    231-278 (279)
 63 cd05622 STKc_ROCK1 Catalytic d  97.9 1.9E-05 4.1E-10   56.8   4.1   76    3-84    284-369 (371)
 64 cd05577 STKc_GRK Catalytic dom  97.8 1.8E-05 3.9E-10   54.1   2.8   43    2-44    230-276 (277)
 65 cd05623 STKc_MRCK_alpha Cataly  97.8 3.6E-05 7.8E-10   54.3   4.3   31   14-46    258-288 (332)
 66 cd05632 STKc_GRK5 Catalytic do  97.8 1.8E-05   4E-10   54.4   2.7   43    3-45    238-284 (285)
 67 KOG0606|consensus               97.7 6.8E-06 1.5E-10   66.0   0.1   75    2-83    293-375 (1205)
 68 cd05597 STKc_DMPK_like Catalyt  97.7 6.7E-05 1.4E-09   52.9   4.7   41    3-46    246-288 (331)
 69 cd05598 STKc_LATS Catalytic do  97.6 8.3E-05 1.8E-09   53.2   4.0   50    6-61    283-334 (376)
 70 cd05600 STKc_Sid2p_Dbf2p Catal  97.5 6.7E-05 1.5E-09   52.8   2.5   42    2-46    238-279 (333)
 71 cd05613 STKc_MSK1_N N-terminal  97.5 4.4E-05 9.4E-10   52.4   1.4   43    2-44    244-290 (290)
 72 cd05624 STKc_MRCK_beta Catalyt  97.5 9.2E-05   2E-09   52.2   2.7   31   14-46    258-288 (331)
 73 cd05606 STKc_beta_ARK Catalyti  97.4 0.00011 2.3E-09   50.5   2.8   42    3-44    232-277 (278)
 74 PF00433 Pkinase_C:  Protein ki  97.4 8.3E-05 1.8E-09   38.8   1.3   36   51-86      2-47  (48)
 75 cd05609 STKc_MAST Catalytic do  97.2 0.00028 6.2E-09   48.9   2.4   44    1-46    250-295 (305)
 76 cd05610 STKc_MASTL Catalytic d  97.0  0.0003 6.6E-09   54.6   1.7   52    2-61    615-666 (669)
 77 cd05574 STKc_phototropin_like   97.0 0.00029 6.2E-09   49.0   1.1   43    2-46    266-311 (316)
 78 KOG0606|consensus               96.5  0.0019 4.1E-08   52.5   2.6   56    3-65   1071-1128(1205)
 79 cd07869 STKc_PFTAIRE1 Catalyti  95.8  0.0028 6.1E-08   43.9   0.4   29    2-31    269-297 (303)
 80 PLN03225 Serine/threonine-prot  94.5   0.013 2.9E-07   44.9   0.5   30    2-32    431-460 (566)
 81 cd07859 STKc_TDY_MAPK_plant Ca  94.2   0.015 3.3E-07   40.6   0.2   28    2-30    271-298 (338)
 82 cd06644 STKc_STK10_LOK Catalyt  93.9   0.019 4.1E-07   39.4   0.4   33    2-35    250-282 (292)
 83 PHA03207 serine/threonine kina  93.9   0.016 3.5E-07   41.9   0.0   33    2-35    356-388 (392)
 84 PTZ00284 protein kinase; Provi  93.7   0.023 4.9E-07   42.1   0.4   26    1-27    418-443 (467)
 85 cd07875 STKc_JNK1 Catalytic do  93.5   0.036 7.7E-07   39.5   1.2   25    1-26    298-322 (364)
 86 cd07873 STKc_PCTAIRE1 Catalyti  93.4   0.026 5.7E-07   38.9   0.4   28    1-29    266-293 (301)
 87 cd07872 STKc_PCTAIRE2 Catalyti  93.3   0.023 5.1E-07   39.4   0.0   27    1-28    266-292 (309)
 88 PTZ00036 glycogen synthase kin  93.2   0.017 3.6E-07   42.7  -0.9   29    1-30    331-359 (440)
 89 cd06616 PKc_MKK4 Catalytic dom  92.9   0.025 5.5E-07   38.6  -0.3   32    2-34    248-279 (288)
 90 PHA03210 serine/threonine kina  92.2   0.049 1.1E-06   41.0   0.4   34    2-36    435-468 (501)
 91 cd07853 STKc_NLK Catalytic dom  92.0   0.049 1.1E-06   39.0   0.2   28    2-30    269-296 (372)
 92 cd07876 STKc_JNK2 Catalytic do  91.7   0.055 1.2E-06   38.4   0.2   25    2-27    296-320 (359)
 93 PHA03212 serine/threonine kina  91.7   0.047   1E-06   39.7  -0.2   26    1-27    356-381 (391)
 94 KOG0585|consensus               91.2   0.041 8.9E-07   41.8  -0.9   25    1-26    352-376 (576)
 95 cd07845 STKc_CDK10 Catalytic d  91.2   0.059 1.3E-06   37.3  -0.1   25    2-27    271-295 (309)
 96 cd07879 STKc_p38delta_MAPK13 C  91.2   0.058 1.3E-06   38.1  -0.2   29    2-31    278-306 (342)
 97 cd07878 STKc_p38beta_MAPK11 Ca  90.8   0.081 1.8E-06   37.2   0.3   26    2-28    279-304 (343)
 98 cd06649 PKc_MEK2 Catalytic dom  90.6   0.055 1.2E-06   38.1  -0.7   27    2-29    282-308 (331)
 99 cd07858 STKc_TEY_MAPK_plant Ca  90.6    0.06 1.3E-06   37.9  -0.5   26    2-28    272-297 (337)
100 cd07851 STKc_p38 Catalytic dom  90.3    0.11 2.5E-06   36.6   0.7   25    2-27    279-303 (343)
101 cd08216 PK_STRAD Pseudokinase   90.1   0.076 1.7E-06   36.7  -0.3   26    2-28    276-301 (314)
102 KOG0615|consensus               89.7    0.11 2.3E-06   38.9   0.2   28    2-30    418-445 (475)
103 cd08227 PK_STRAD_alpha Pseudok  89.5   0.073 1.6E-06   37.3  -0.8   27    2-29    288-314 (327)
104 cd06617 PKc_MKK3_6 Catalytic d  89.5    0.08 1.7E-06   35.9  -0.6   29    2-31    242-270 (283)
105 cd07849 STKc_ERK1_2_like Catal  89.1    0.13 2.7E-06   36.2   0.2   26    2-28    273-298 (336)
106 cd07854 STKc_MAPK4_6 Catalytic  89.1    0.15 3.2E-06   36.1   0.5   26    2-28    281-306 (342)
107 cd07841 STKc_CDK7 Catalytic do  89.0    0.12 2.7E-06   35.3   0.1   25    2-27    263-287 (298)
108 cd06650 PKc_MEK1 Catalytic dom  88.9   0.092   2E-06   37.1  -0.6   27    1-28    279-305 (333)
109 cd07834 STKc_MAPK Catalytic do  88.9   0.092   2E-06   36.6  -0.6   26    2-28    270-295 (330)
110 PTZ00024 cyclin-dependent prot  88.4    0.16 3.5E-06   35.6   0.3   26    2-28    294-319 (335)
111 cd08226 PK_STRAD_beta Pseudoki  88.3    0.06 1.3E-06   37.7  -1.9   26    1-27    288-313 (328)
112 PLN00034 mitogen-activated pro  88.2    0.16 3.4E-06   36.1   0.2   26    2-28    309-334 (353)
113 KOG0665|consensus               88.0    0.18 3.9E-06   36.6   0.3   39    1-44    290-328 (369)
114 cd07880 STKc_p38gamma_MAPK12 C  87.6    0.15 3.2E-06   36.1  -0.3   26    2-28    279-304 (343)
115 cd07874 STKc_JNK3 Catalytic do  87.6    0.17 3.8E-06   35.8   0.1   25    2-27    292-316 (355)
116 cd07856 STKc_Sty1_Hog1 Catalyt  87.5    0.18   4E-06   35.5   0.1   24    2-26    269-292 (328)
117 cd06621 PKc_MAPKK_Pek1_like Ca  87.3    0.22 4.7E-06   34.1   0.4   27    2-29    247-273 (287)
118 cd06611 STKc_SLK_like Catalyti  87.0     0.2 4.4E-06   33.9   0.1   29    2-31    243-271 (280)
119 KOG0575|consensus               86.4    0.21 4.6E-06   38.6   0.0   24    1-25    249-272 (592)
120 cd06609 STKc_MST3_like Catalyt  86.2    0.22 4.8E-06   33.7  -0.0   27    2-29    232-258 (274)
121 cd06619 PKc_MKK5 Catalytic dom  85.6    0.27 5.8E-06   33.5   0.2   27    2-29    234-260 (279)
122 KOG0583|consensus               85.5    0.25 5.3E-06   36.1  -0.1   26    2-28    256-281 (370)
123 cd07850 STKc_JNK Catalytic dom  85.3    0.24 5.3E-06   35.1  -0.2   25    1-26    291-315 (353)
124 cd07855 STKc_ERK5 Catalytic do  85.1    0.24 5.2E-06   34.8  -0.3   24    2-26    275-298 (334)
125 cd06615 PKc_MEK Catalytic doma  84.5    0.28 6.2E-06   34.0  -0.1   25    2-27    268-292 (308)
126 cd07877 STKc_p38alpha_MAPK14 C  83.3    0.34 7.4E-06   34.3  -0.1   25    2-27    281-305 (345)
127 cd06658 STKc_PAK5 Catalytic do  83.1     0.3 6.6E-06   33.6  -0.4   25    2-27    253-277 (292)
128 KOG0581|consensus               82.4    0.31 6.7E-06   35.7  -0.6   24    3-27    317-340 (364)
129 cd06643 STKc_SLK Catalytic dom  82.0    0.42 9.2E-06   32.4  -0.0   25    2-27    243-267 (282)
130 cd06622 PKc_MAPKK_PBS2_like Ca  82.0    0.42 9.1E-06   32.5  -0.1   26    2-28    243-268 (286)
131 KOG0588|consensus               81.9    0.66 1.4E-05   36.8   0.9   39    1-41    243-281 (786)
132 KOG0604|consensus               81.6    0.39 8.4E-06   34.9  -0.3   26    1-27    302-327 (400)
133 cd06917 STKc_NAK1_like Catalyt  81.0    0.45 9.8E-06   32.1  -0.2   27    2-29    236-262 (277)
134 KOG0579|consensus               80.7    0.56 1.2E-05   37.5   0.2   31    1-32    269-299 (1187)
135 cd07852 STKc_MAPK15 Catalytic   79.8    0.51 1.1E-05   33.1  -0.2   26    2-28    276-301 (337)
136 cd06656 STKc_PAK3 Catalytic do  79.4    0.63 1.4E-05   32.1   0.1   24    2-26    250-273 (297)
137 cd06648 STKc_PAK_II Catalytic   79.2    0.67 1.4E-05   31.7   0.2   26    2-28    250-275 (285)
138 KOG1167|consensus               78.9    0.65 1.4E-05   34.6   0.0   28    1-29    361-388 (418)
139 KOG0593|consensus               77.6    0.43 9.4E-06   34.7  -1.1   26    1-27    264-289 (396)
140 cd06657 STKc_PAK4 Catalytic do  77.5    0.57 1.2E-05   32.3  -0.6   24    2-26    251-274 (292)
141 cd06633 STKc_TAO3 Catalytic do  77.5    0.86 1.9E-05   31.7   0.3   27    2-29    254-280 (313)
142 cd06618 PKc_MKK7 Catalytic dom  77.4    0.67 1.5E-05   31.8  -0.2   24    2-26    254-277 (296)
143 cd06614 STKc_PAK Catalytic dom  76.9    0.59 1.3E-05   31.8  -0.6   30    2-32    251-280 (286)
144 cd06647 STKc_PAK_I Catalytic d  76.0    0.63 1.4E-05   32.0  -0.7   27    2-29    250-276 (293)
145 KOG0582|consensus               75.2     1.1 2.3E-05   34.1   0.4   26    4-30    276-301 (516)
146 cd07857 STKc_MPK1 Catalytic do  75.2    0.93   2E-05   31.8   0.0   24    2-26    273-296 (332)
147 KOG0603|consensus               74.8    0.93   2E-05   35.4  -0.1   24    1-25    543-566 (612)
148 KOG0032|consensus               74.6     1.4   3E-05   32.4   0.8   26    2-28    274-299 (382)
149 cd06654 STKc_PAK1 Catalytic do  74.6    0.92   2E-05   31.2  -0.1   25    2-27    251-275 (296)
150 cd06640 STKc_MST4 Catalytic do  73.7    0.83 1.8E-05   31.0  -0.5   28    2-30    234-261 (277)
151 cd06655 STKc_PAK2 Catalytic do  72.7    0.75 1.6E-05   31.7  -0.9   25    2-27    250-274 (296)
152 KOG0660|consensus               72.6       1 2.2E-05   33.0  -0.3   27    1-28    290-316 (359)
153 cd06659 STKc_PAK6 Catalytic do  71.4     1.2 2.7E-05   30.7  -0.1   24    2-26    252-275 (297)
154 cd06607 STKc_TAO Catalytic dom  71.3     1.1 2.4E-05   30.9  -0.3   25    2-27    248-272 (307)
155 KOG0599|consensus               70.6    0.83 1.8E-05   32.9  -1.1   26    2-28    264-289 (411)
156 cd06634 STKc_TAO2 Catalytic do  70.1     1.6 3.4E-05   30.2   0.2   25    2-27    248-272 (308)
157 cd06642 STKc_STK25-YSK1 Cataly  69.1    0.53 1.1E-05   31.9  -2.3   29    2-31    234-262 (277)
158 KOG4717|consensus               68.1     1.5 3.3E-05   34.2  -0.2   30    2-32    251-280 (864)
159 KOG1027|consensus               68.0     2.5 5.4E-05   34.4   0.9   24    2-26    748-771 (903)
160 cd06620 PKc_MAPKK_Byr1_like Ca  67.7     1.7 3.8E-05   29.5   0.0   24    2-26    247-270 (284)
161 KOG0663|consensus               66.6     2.4 5.2E-05   31.3   0.5   27    1-28    341-367 (419)
162 KOG0666|consensus               66.4     1.8 3.8E-05   31.8  -0.2   26    1-27    317-342 (438)
163 cd06641 STKc_MST3 Catalytic do  65.4     1.3 2.9E-05   29.9  -0.9   24    3-27    235-258 (277)
164 KOG0607|consensus               56.4     2.2 4.8E-05   31.5  -1.1   29    2-31    342-370 (463)
165 KOG0578|consensus               54.6     2.9 6.3E-05   32.3  -0.8   25    1-26    503-527 (550)
166 KOG0594|consensus               53.2     4.6 9.9E-05   29.3   0.0   26    2-28    283-308 (323)
167 KOG0033|consensus               51.2     4.1   9E-05   29.1  -0.4   27    2-29    248-274 (355)
168 KOG0667|consensus               51.0     4.9 0.00011   31.4  -0.1   29    1-30    482-510 (586)
169 KOG0597|consensus               48.8       3 6.4E-05   33.0  -1.5   25    2-27    232-256 (808)
170 KOG0668|consensus               47.9     3.1 6.7E-05   29.4  -1.4   25    3-28    304-328 (338)
171 KOG0198|consensus               47.4     5.6 0.00012   28.7  -0.2   26    1-27    256-281 (313)
172 cd06635 STKc_TAO1 Catalytic do  47.1     5.3 0.00012   27.7  -0.4   24    2-26    258-281 (317)
173 PLN00181 protein SPA1-RELATED;  46.0     6.6 0.00014   31.4  -0.1   24    3-27    247-270 (793)
174 KOG0669|consensus               45.2     5.6 0.00012   28.5  -0.5   24    2-26    296-319 (376)
175 KOG0658|consensus               44.9     4.5 9.8E-05   29.8  -1.0   24    2-26    287-310 (364)
176 PTZ00283 serine/threonine prot  44.6     4.2   9E-05   30.7  -1.3   26    2-28    278-303 (496)
177 KOG0659|consensus               44.6     6.6 0.00014   28.2  -0.2   25    1-26    261-285 (318)
178 KOG0661|consensus               42.0     8.9 0.00019   29.5   0.1   24    2-26    272-295 (538)
179 KOG0596|consensus               40.8     9.2  0.0002   30.1   0.0   26    2-28    608-633 (677)
180 KOG4038|consensus               32.7      23 0.00049   22.2   0.8   25   76-100    89-116 (150)
181 KOG0590|consensus               30.7      14  0.0003   29.0  -0.4   27    2-29    566-592 (601)
182 KOG0983|consensus               29.4      26 0.00057   25.5   0.8   25    4-29    332-356 (391)
183 PTZ00267 NIMA-related protein   26.9      10 0.00022   28.4  -1.7   26    2-28    304-329 (478)
184 PF14623 Vint:  Hint-domain      26.8      23 0.00049   23.2   0.1   11   17-27    118-128 (162)
185 KOG0586|consensus               26.7      25 0.00055   27.7   0.4   26    1-27    286-311 (596)
186 PF14684 Tricorn_C1:  Tricorn p  25.4       6 0.00013   21.9  -2.4   12   25-36     24-35  (70)
187 KOG0600|consensus               23.1      29 0.00063   27.0   0.1   24    2-26    381-404 (560)
188 PF03790 KNOX1:  KNOX1 domain ;  22.5      27 0.00059   17.9  -0.1   25   17-41      5-29  (45)
189 PTZ00266 NIMA-related protein   21.5      19 0.00041   30.2  -1.2   28    2-30    276-303 (1021)
190 KOG1290|consensus               20.8      59  0.0013   25.5   1.3   24    5-29    534-557 (590)
191 PF03720 UDPG_MGDP_dh_C:  UDP-g  20.7      25 0.00055   20.7  -0.5   25   20-44     74-98  (106)
192 KOG0201|consensus               20.5      31 0.00068   26.3  -0.1   24    4-28    246-269 (467)

No 1  
>KOG0694|consensus
Probab=99.83  E-value=1.9e-21  Score=146.07  Aligned_cols=81  Identities=30%  Similarity=0.636  Sum_probs=71.3

Q ss_pred             CCCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC--------
Q psy10             1 MPKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI--------   68 (100)
Q Consensus         1 l~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~--------   68 (100)
                      |+++|+|+|.+||+    |+++||.||||+.|||++|++|+++|||+|.+     ++..|.+|||++++.+.        
T Consensus       599 l~~ll~k~p~kRLG~~e~d~~~i~~hpFFr~i~w~~L~~r~i~PPf~P~i-----~~~~D~snFd~eFt~e~p~Lt~~~~  673 (694)
T KOG0694|consen  599 MRRLLRKNPEKRLGSGERDAEDIKKHPFFRSIDWDDLLNRRIKPPFVPTI-----KGPEDVSNFDEEFTSEKPALTPSDP  673 (694)
T ss_pred             HHHHhccCcccccCCCCCCchhhhhCCccccCCHHHHhhccCCCCCCccc-----CChhhhcccchhhhcCCCccCCCCc
Confidence            56889999999985    49999999999999999999999999999995     78999999999998653        


Q ss_pred             -CCChhhhcccCCcccCCC
Q psy10            69 -KLTEADQDLYKNFPLTIS   86 (100)
Q Consensus        69 -~~~~~~~~~F~~Fsy~~~   86 (100)
                       .++..+|..|.||+|+++
T Consensus       674 ~~l~~~~q~~F~~Fs~~~~  692 (694)
T KOG0694|consen  674 RPLTEEEQEAFRDFSFVAE  692 (694)
T ss_pred             cccchhhHHHhcCccccCC
Confidence             244677899999999876


No 2  
>KOG0986|consensus
Probab=99.80  E-value=1.6e-20  Score=136.82  Aligned_cols=88  Identities=39%  Similarity=0.659  Sum_probs=78.7

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCCCChhhhcccCCc
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTEADQDLYKNF   81 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~~~~~~~~~F~~F   81 (100)
                      +|++.++++.|..|+++||+||||++|||..|.+.+++|||+|....|++++..|+++|+  .++++.++..|++.|..|
T Consensus       426 ~Kdp~~RLGcrg~ga~evk~HpfFk~lnw~rleagml~PPfiPdp~aVyakDv~DIeqFs--~VKGV~ld~~D~~fy~~F  503 (591)
T KOG0986|consen  426 TKDPEKRLGCRGEGAQEVKEHPFFKDLNWRRLEAGMLEPPFIPDPGAVYAKDVLDIEQFS--TVKGVKLDDTDTDFYKNF  503 (591)
T ss_pred             ccCHHHhccCCCcCcchhhhCcccccCCHhHHhccCCCCCCCCCccccchhhhhhhhhcc--cccceecccccHHHHHhc
Confidence            445555555555699999999999999999999999999999999999999999999999  778888999999999999


Q ss_pred             cc-CCCHHHHH
Q psy10            82 PL-TISERLAE   91 (100)
Q Consensus        82 sy-~~~~~~~~   91 (100)
                      .. ..|++||+
T Consensus       504 ~tg~vsipWQn  514 (591)
T KOG0986|consen  504 ATGSVSIPWQN  514 (591)
T ss_pred             cCCcccchHHH
Confidence            99 59999997


No 3  
>KOG0598|consensus
Probab=99.67  E-value=1.6e-17  Score=117.80  Aligned_cols=81  Identities=27%  Similarity=0.540  Sum_probs=65.6

Q ss_pred             CCCccCCCCCccc---CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCC--------
Q psy10             1 MPKHKAKTPIQQQ---LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIK--------   69 (100)
Q Consensus         1 l~k~l~k~p~~r~---~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~--------   69 (100)
                      |+++|+++|.+|+   +|+.+|++||||++|||+.|.++++.|||+|.+     .+..|.++|+.+++....        
T Consensus       257 l~~LL~rdp~~RLg~~~d~~~ik~HpfF~~inW~~l~~k~l~PpF~P~~-----~~~~~~~~Fd~eft~~~~~~~~~~~~  331 (357)
T KOG0598|consen  257 LKKLLKRDPRQRLGGPGDAEEIKRHPFFKGINWEKLLAKKLSPPFKPNV-----TGLEDTSNFDNEFTSYTVDYSPVDSS  331 (357)
T ss_pred             HHHHhccCHHHhcCCCCChHHhhcCcccccCCHHHHHhcCCCCCeecCC-----CCccccccccHHHHhccccCCccccC
Confidence            4678999999998   689999999999999999999999999999995     677888888887765421        


Q ss_pred             --------CChhhhcccCCcccCCC
Q psy10            70 --------LTEADQDLYKNFPLTIS   86 (100)
Q Consensus        70 --------~~~~~~~~F~~Fsy~~~   86 (100)
                              .+...+..|.||+|..+
T Consensus       332 ~~~~~~~~~~~~~~~~f~gft~~~~  356 (357)
T KOG0598|consen  332 PDMSAFTAFSRTYNKIFPGFTYVAS  356 (357)
T ss_pred             cccccccccccccccccCCccccCC
Confidence                    11233457999998754


No 4  
>KOG0696|consensus
Probab=99.67  E-value=2.1e-17  Score=120.14  Aligned_cols=81  Identities=27%  Similarity=0.462  Sum_probs=66.1

Q ss_pred             ccCCCCCccc----CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCC-CC-------
Q psy10             4 HKAKTPIQQQ----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIK-LT-------   71 (100)
Q Consensus         4 ~l~k~p~~r~----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~-~~-------   71 (100)
                      +|+|.|++|+    .|-.+|+.||||+.|||++|.+++|+|||.|.+     +...+.+||+..+++..+ ++       
T Consensus       584 ~ltK~P~kRLGcg~~ge~di~~H~FFR~iDWek~E~~eiqPPfkPk~-----k~~r~~eNFD~~Ft~~~~~lTPpD~~v~  658 (683)
T KOG0696|consen  584 LLTKHPGKRLGCGPEGERDIREHPFFRRIDWEKLERREIQPPFKPKI-----KCGRDAENFDKFFTREPTDLTPPDKLVM  658 (683)
T ss_pred             HhhcCCccccCCCCccccchhhCcchhhccHHHHhhccCCCCCCCcc-----ccCCchhhhhHHHhcCCCCCCCchHHHH
Confidence            3556666665    477899999999999999999999999999985     567888999998887542 22       


Q ss_pred             -hhhhcccCCcccCCCHHH
Q psy10            72 -EADQDLYKNFPLTISERL   89 (100)
Q Consensus        72 -~~~~~~F~~Fsy~~~~~~   89 (100)
                       +.+|+.|.||||++|+..
T Consensus       659 ~nldq~eF~gFsfvNpefv  677 (683)
T KOG0696|consen  659 MNLDQSEFEGFSFVNPEFV  677 (683)
T ss_pred             hcCchhhcCceeeeChhhc
Confidence             356889999999998654


No 5  
>KOG0690|consensus
Probab=99.62  E-value=2.2e-16  Score=112.23  Aligned_cols=79  Identities=30%  Similarity=0.490  Sum_probs=65.0

Q ss_pred             CccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC-CCC------
Q psy10             3 KHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI-KLT------   71 (100)
Q Consensus         3 k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~-~~~------   71 (100)
                      -+|+|+|.+|++    ++.||+.|+||++|||++++.|++.|||+|++     .+..|+++||++++... .++      
T Consensus       401 GLL~kdP~kRLGgGpdDakEi~~h~FF~~v~W~~~~~Kki~PPfKPqV-----tSetDTryFD~EFT~q~v~lTPP~r~~  475 (516)
T KOG0690|consen  401 GLLKKDPKKRLGGGPDDAKEIMRHRFFASVDWEATYRKKIEPPFKPQV-----TSETDTRYFDEEFTSQPVTLTPPDRYG  475 (516)
T ss_pred             HHhhcChHhhcCCCchhHHHHHhhhhhccCCHHHHHHhccCCCCCCCc-----ccccchhhhhhhhhcceeEecCCCCCC
Confidence            467788888874    47899999999999999999999999999995     78999999999998643 222      


Q ss_pred             ------hhhhcccCCcccCCC
Q psy10            72 ------EADQDLYKNFPLTIS   86 (100)
Q Consensus        72 ------~~~~~~F~~Fsy~~~   86 (100)
                            .+.+.+|..|+|.+.
T Consensus       476 ~~~~~~~e~~~~FpQFsy~~~  496 (516)
T KOG0690|consen  476 STVDEDEERRPHFPQFSYSAS  496 (516)
T ss_pred             cccchhhhhccCCcceeeecc
Confidence                  234678999999654


No 6  
>KOG0605|consensus
Probab=99.59  E-value=4.5e-16  Score=114.88  Aligned_cols=54  Identities=28%  Similarity=0.622  Sum_probs=47.0

Q ss_pred             CCccCCCCCcccC--ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCcc
Q psy10             2 PKHKAKTPIQQQL--RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEE   63 (100)
Q Consensus         2 ~k~l~k~p~~r~~--g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~   63 (100)
                      .|+++ +|.+|++  |++|||.||||++|+|+.|+.  +.|||+|.+     .+..|+.+|++.
T Consensus       424 ~rll~-d~~~RLG~~G~~EIK~HPfF~~v~W~~l~~--~~apfvP~v-----~~~~DT~yFddF  479 (550)
T KOG0605|consen  424 TRLLC-DPENRLGSKGAEEIKKHPFFKGVDWDHLRE--MPAPFVPQV-----NSELDTQYFDDF  479 (550)
T ss_pred             HHHhc-CHHHhcCcccHHHHhcCCccccCCcchhhc--CCCCCCCCC-----CCcccccccccC
Confidence            46777 8999997  999999999999999999987  569999995     677888888853


No 7  
>KOG0695|consensus
Probab=99.58  E-value=6.5e-16  Score=110.36  Aligned_cols=80  Identities=25%  Similarity=0.467  Sum_probs=66.8

Q ss_pred             ccCCCCCccc-----CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC-CCC------
Q psy10             4 HKAKTPIQQQ-----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI-KLT------   71 (100)
Q Consensus         4 ~l~k~p~~r~-----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~-~~~------   71 (100)
                      -|.|+|..|+     .|+.+|+.|+||+.|||++|.+|.+.|||.|.+     .+.++..+|+..++.+. .++      
T Consensus       493 flnkdp~erlgc~~~~g~~dik~h~ffr~idwd~leqk~v~ppf~p~i-----~~d~~l~~fd~qft~e~~qltpdd~d~  567 (593)
T KOG0695|consen  493 FLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEQKQVLPPFQPQI-----TDDYGLDNFDTQFTSEPVQLTPDDEDA  567 (593)
T ss_pred             hhcCCcHHhcCCCcccchhhhhcchhhhhCCHHHHhhcccCCCCCCcc-----ccccCccccccccccCCcccCCCCHHH
Confidence            4677777776     499999999999999999999999999999995     68889999998888654 333      


Q ss_pred             --hhhhcccCCcccCCCHH
Q psy10            72 --EADQDLYKNFPLTISER   88 (100)
Q Consensus        72 --~~~~~~F~~Fsy~~~~~   88 (100)
                        ..+|..|.||.|++|..
T Consensus       568 i~ridqsefegfeyinpl~  586 (593)
T KOG0695|consen  568 IKRIDQSEFEGFEYINPLL  586 (593)
T ss_pred             HHhcchhhcCcceecchhh
Confidence              24578999999998754


No 8  
>KOG0616|consensus
Probab=99.53  E-value=4e-15  Score=104.07  Aligned_cols=77  Identities=25%  Similarity=0.524  Sum_probs=57.8

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCC---CCCChhhhcc
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKG---IKLTEADQDL   77 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~---~~~~~~~~~~   77 (100)
                      |++++++|.+.-.+|..+||+||||++++|+++.+|+++|||+|..    .....|+++|+...+..   ...+....+.
T Consensus       276 L~vD~t~R~gnlknG~~dIk~H~wF~~v~W~~i~~r~ie~P~~pp~----~~~~gdtsnfd~y~e~~~~~~~~~~~~~~~  351 (355)
T KOG0616|consen  276 LQVDLTKRFGNLKNGVEDIKNHPWFKGVDWEAILQRKIEPPFEPPN----IHGPGDTSNFDDYEEEDTLGISEDQKCAKL  351 (355)
T ss_pred             HhhhhHhhhcCcCCCccccccCcccccccHHHHhhccccCCCCCcc----ccCCccccccccccccccccccCCHHHHHH
Confidence            4556666666656899999999999999999999999999999943    46788899998644332   2334455566


Q ss_pred             cCCc
Q psy10            78 YKNF   81 (100)
Q Consensus        78 F~~F   81 (100)
                      |.+|
T Consensus       352 f~ef  355 (355)
T KOG0616|consen  352 FAEF  355 (355)
T ss_pred             HhcC
Confidence            6654


No 9  
>KOG0612|consensus
Probab=99.34  E-value=1e-12  Score=103.88  Aligned_cols=71  Identities=23%  Similarity=0.485  Sum_probs=52.7

Q ss_pred             CCCccc--CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccC-----CCC-----CChhhh
Q psy10             8 TPIQQQ--LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTK-----GIK-----LTEADQ   75 (100)
Q Consensus         8 ~p~~r~--~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~-----~~~-----~~~~~~   75 (100)
                      ++..|+  +|++|||.||||.|++|+.|..  ..|||+|.+     .+..|++||+.....     ..+     .-.+.+
T Consensus       322 ~~e~RLgrngiedik~HpFF~g~~W~~iR~--~~pP~vPev-----ssd~DTsnFd~~~dd~~~~e~~p~~~~~~f~Gn~  394 (1317)
T KOG0612|consen  322 DREVRLGRNGIEDIKNHPFFEGIDWDNIRE--SVPPVVPEV-----SSDDDTSNFDVDEDDLRDAETFPPRIPKAFSGNH  394 (1317)
T ss_pred             ChhhhcccccHHHHHhCccccCCChhhhhh--cCCCCCCcC-----CCCCccccccccccccchhhccCCCCCCCCcCCc
Confidence            455665  6999999999999999998865  889999995     788999999532211     001     113456


Q ss_pred             cccCCcccCC
Q psy10            76 DLYKNFPLTI   85 (100)
Q Consensus        76 ~~F~~Fsy~~   85 (100)
                      --|.||||..
T Consensus       395 LPFIGfTy~~  404 (1317)
T KOG0612|consen  395 LPFIGFTYTH  404 (1317)
T ss_pred             CCeeeeeecc
Confidence            6899999973


No 10 
>KOG0610|consensus
Probab=99.31  E-value=1.2e-12  Score=94.86  Aligned_cols=45  Identities=33%  Similarity=0.644  Sum_probs=39.4

Q ss_pred             CCCccCCCCCcccC---ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCC
Q psy10             1 MPKHKAKTPIQQQL---RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRG   47 (100)
Q Consensus         1 l~k~l~k~p~~r~~---g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~   47 (100)
                      |+++|.|+|.+|++   |+.|||.||||+||||+.+  +.+.||++|...
T Consensus       368 Ir~LLvKdP~kRlg~~rGA~eIK~HpFF~gVnWaLi--r~~~PP~iP~~~  415 (459)
T KOG0610|consen  368 IRKLLVKDPSKRLGSKRGAAEIKRHPFFEGVNWALI--RCARPPEIPKPV  415 (459)
T ss_pred             HHHHhccChhhhhccccchHHhhcCccccCCChhhe--eccCCCcCCCcc
Confidence            47899999999985   9999999999999999943  558999999753


No 11 
>smart00133 S_TK_X Extension to Ser/Thr-type protein kinases.
Probab=99.15  E-value=3.7e-11  Score=66.35  Aligned_cols=54  Identities=24%  Similarity=0.586  Sum_probs=39.7

Q ss_pred             CCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCC----CCh-----hhhcccCCcccC
Q psy10            26 TGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIK----LTE-----ADQDLYKNFPLT   84 (100)
Q Consensus        26 ~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~----~~~-----~~~~~F~~Fsy~   84 (100)
                      ++|||++|++|++.|||+|.+     .+..|+++|+..++....    ...     ..+..|.||+|.
T Consensus         1 ~~idW~~l~~r~~~pP~~P~~-----~~~~d~s~fd~~~~~~~~~~s~~~~~~~~~~~~~~F~gfsy~   63 (64)
T smart00133        1 RGIDWDKLENKEIEPPFVPKI-----KSPTDTSNFDDEFTEETPVLTPVDSPASGGSQQEPFRGFSYV   63 (64)
T ss_pred             CCCCHHHHHhCCCCCCccccc-----CCccHHhHcCCcCCCCCCCCCCCCccccccccccccCCCccc
Confidence            579999999999999999985     567788888875544321    111     114689999995


No 12 
>KOG0614|consensus
Probab=99.09  E-value=3.4e-11  Score=89.74  Aligned_cols=51  Identities=29%  Similarity=0.687  Sum_probs=46.2

Q ss_pred             CCCccc----CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCcc
Q psy10             8 TPIQQQ----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEE   63 (100)
Q Consensus         8 ~p~~r~----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~   63 (100)
                      +|+.|+    +|+.||+.|.||.++||+.|..+.++|||+|.+     ++..|++||+..
T Consensus       659 ~P~ERLG~~~~gI~DIkkH~Wf~gfdweglr~~~L~pPi~~~v-----a~ptD~s~Fd~~  713 (732)
T KOG0614|consen  659 NPTERLGYQKGGINDIKKHRWFEGFDWEGLRSRTLPPPIIPSV-----ANPTDVSNFDNF  713 (732)
T ss_pred             CcHhhhccccCChHHHHhhhhhhcCChhhhhhccCCCCccccC-----CCcccchhccCC
Confidence            577776    699999999999999999999999999999995     788999999864


No 13 
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=99.07  E-value=1.5e-10  Score=81.51  Aligned_cols=79  Identities=24%  Similarity=0.476  Sum_probs=59.3

Q ss_pred             CCCccCCCCCcccC-----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC-------
Q psy10             1 MPKHKAKTPIQQQL-----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI-------   68 (100)
Q Consensus         1 l~k~l~k~p~~r~~-----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~-------   68 (100)
                      |++.|.++|..|++     +.++|+.||||++++|+.+..+++.|||.|..     .+..+.++|+..+....       
T Consensus       234 i~~~L~~dP~~R~~~~~~~~~~~i~~h~~f~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~  308 (327)
T cd05617         234 LKGFLNKDPKERLGCQPQTGFSDIKSHTFFRSIDWDLLEKKQVTPPFKPQI-----TDDYGLENFDTQFTSEPVQLTPDD  308 (327)
T ss_pred             HHHHhccCHHHcCCCCCCCCHHHHHcCCCCCCCCHHHHHhCCCCCCccCCC-----CCCcchhhcCCccccCcccCCCCC
Confidence            35678889999974     68999999999999999999999999999985     45556666664433221       


Q ss_pred             --CCChhhhcccCCcccC
Q psy10            69 --KLTEADQDLYKNFPLT   84 (100)
Q Consensus        69 --~~~~~~~~~F~~Fsy~   84 (100)
                        .+...++..|.||.|.
T Consensus       309 ~~~~~~~~~~~~~~~~~~  326 (327)
T cd05617         309 EDVIKRIDQSEFEGFEYI  326 (327)
T ss_pred             ccccccccccccCCCcCC
Confidence              1223456789999885


No 14 
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=99.03  E-value=1.9e-10  Score=80.78  Aligned_cols=79  Identities=28%  Similarity=0.493  Sum_probs=59.7

Q ss_pred             CCccCCCCCcccC-----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC--------
Q psy10             2 PKHKAKTPIQQQL-----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI--------   68 (100)
Q Consensus         2 ~k~l~k~p~~r~~-----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~--------   68 (100)
                      ++.|.++|..|.+     |.++|+.||||.+++|+.+..+.+.|||.|..     .+..|.++|+.+.....        
T Consensus       228 ~~~L~~dP~~R~~~~~~~~~~~~~~h~~f~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~  302 (320)
T cd05590         228 KAFMTKNPTMRLGSLTLGGEEAILRHPFFKELDWEKLNRRQIEPPFRPRI-----KSREDVSNFDPDFIKEDPVLTPIEE  302 (320)
T ss_pred             HHHcccCHHHCCCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCC-----CCcchhhhcCcccccCCccCCCCcc
Confidence            4667888888863     46899999999999999999999999999985     45667777775443321        


Q ss_pred             -CCChhhhcccCCcccCC
Q psy10            69 -KLTEADQDLYKNFPLTI   85 (100)
Q Consensus        69 -~~~~~~~~~F~~Fsy~~   85 (100)
                       .+....++.|++|+|.+
T Consensus       303 ~~~~~~~~~~~~~~~~~~  320 (320)
T cd05590         303 SLLPMINQDEFRNFSYTA  320 (320)
T ss_pred             cccccccccCcCCCcccC
Confidence             12234567899999853


No 15 
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=99.02  E-value=2.5e-10  Score=80.02  Aligned_cols=79  Identities=28%  Similarity=0.578  Sum_probs=60.1

Q ss_pred             CCCccCCCCCcccCC----hhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC--------
Q psy10             1 MPKHKAKTPIQQQLR----SDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI--------   68 (100)
Q Consensus         1 l~k~l~k~p~~r~~g----~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~--------   68 (100)
                      |++.|.++|..|+.-    ..+++.||||+.++|+.+..+.+.||+.|..     ....+.++|+..+....        
T Consensus       227 i~~~l~~dP~~R~s~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~  301 (318)
T cd05570         227 LKSFLTKNPEKRLGCLPTGEQDIKGHPFFREIDWDKLERKEIKPPFKPKI-----KGRFDVSNFDDEFTKEKPVLTPPDE  301 (318)
T ss_pred             HHHHccCCHHHcCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCCC-----CCcchhhhcCchhccCcccCCCCcc
Confidence            356788889998732    5999999999999999999999999999985     45556666664433221        


Q ss_pred             -CCChhhhcccCCcccC
Q psy10            69 -KLTEADQDLYKNFPLT   84 (100)
Q Consensus        69 -~~~~~~~~~F~~Fsy~   84 (100)
                       .+....|+.|+||+|+
T Consensus       302 ~~~~~~~~~~~~~~~~~  318 (318)
T cd05570         302 AIIRNIDQEEFRGFSYI  318 (318)
T ss_pred             cccccccccccCCCCCC
Confidence             2345678899999994


No 16 
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=99.02  E-value=2.8e-10  Score=79.89  Aligned_cols=80  Identities=25%  Similarity=0.503  Sum_probs=63.2

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC---------CCCh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI---------KLTE   72 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~---------~~~~   72 (100)
                      .+.|.++|.+|+.-..+|+.||||+.++|..+..+.++||+.|..     .+..+.++|+.+.....         .+..
T Consensus       228 ~~~l~~~P~~R~~~~~~l~~h~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  302 (316)
T cd05619         228 VKLFVREPERRLGVKGDIRQHPFFREIDWSALEEREIEPPFKPKV-----KSANDCSNFDKEFLNEKPRLSVTDRMLINS  302 (316)
T ss_pred             HHHhccCHhhcCCChHHHHcCcccCCCCHHHHHhCCCCCCcCCCC-----CCccchhhcChhhhcCCcccCCCccccccc
Confidence            567889999998655699999999999999999999999999985     56667777776554321         2345


Q ss_pred             hhhcccCCcccCCC
Q psy10            73 ADQDLYKNFPLTIS   86 (100)
Q Consensus        73 ~~~~~F~~Fsy~~~   86 (100)
                      .+++.|++|++.+|
T Consensus       303 ~~~~~~~~~~~~~~  316 (316)
T cd05619         303 MDQNMFENFSFINP  316 (316)
T ss_pred             ccccccCCCcccCc
Confidence            67889999999754


No 17 
>KOG0608|consensus
Probab=99.00  E-value=2.7e-10  Score=86.94  Aligned_cols=53  Identities=30%  Similarity=0.518  Sum_probs=43.3

Q ss_pred             cCCCCCccc--CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccc
Q psy10             5 KAKTPIQQQ--LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEED   64 (100)
Q Consensus         5 l~k~p~~r~--~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~   64 (100)
                      |+..+..||  +|+++||+||||++|||..|.+  ..+||||.+     +...|++||+...
T Consensus       909 Lc~sad~RLGkng~d~vKaHpfFkgIDfsslRk--q~ApYIP~I-----tHptDTSNFdpvd  963 (1034)
T KOG0608|consen  909 LCCSADSRLGKNGADQVKAHPFFKGIDFSSLRK--QRAPYIPRI-----THPTDTSNFDPVD  963 (1034)
T ss_pred             HhcChhhhhcccchhhhhcCccccccchHhhhh--ccCCcCccc-----cCCCccccCCcCC
Confidence            556677777  6899999999999999999654  669999995     6788888888543


No 18 
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=98.99  E-value=4.4e-10  Score=78.81  Aligned_cols=81  Identities=27%  Similarity=0.562  Sum_probs=63.7

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC---------CCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI---------KLT   71 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~---------~~~   71 (100)
                      |+++|.++|..|..-..+++.|+||+.++|+.+..+.+.||+.|..     ....+..+|+..++...         .+.
T Consensus       227 l~~~l~~~P~~R~~~~~~l~~h~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (316)
T cd05592         227 LSKLFERDPTKRLGVDGDIRQHPFFRGIDWERLEKREIPPPFKPKV-----KSPSDASNFDREFTNEKVRLSPVDKKLLA  301 (316)
T ss_pred             HHHHccCCHHHcCCChHHHHcCcccCCCCHHHHHhCCCCCCcCCCC-----CCcchhhhcCcccccccccCCCccccccc
Confidence            3567889999998777899999999999999999999999999974     45556667765554321         234


Q ss_pred             hhhhcccCCcccCCC
Q psy10            72 EADQDLYKNFPLTIS   86 (100)
Q Consensus        72 ~~~~~~F~~Fsy~~~   86 (100)
                      ..++..|.+|.|++|
T Consensus       302 ~~~~~~~~~~~~~~~  316 (316)
T cd05592         302 SMDQEQFRGFSFTNP  316 (316)
T ss_pred             cccccccCCCcccCc
Confidence            567889999999765


No 19 
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=98.99  E-value=3.8e-10  Score=79.21  Aligned_cols=78  Identities=29%  Similarity=0.614  Sum_probs=60.7

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCC----------
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKG----------   67 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~----------   67 (100)
                      ++.|.++|.+|+.    .+.+|+.||||++++|..+..+.+.||++|.+     ....|.++|.......          
T Consensus       233 ~~~L~~dP~~R~~~~~~~~~~l~~~~~f~~~~~~~~~~~~~~~~~~~~~-----~~~~d~~~~~~~~~~~~~~~~~~~~~  307 (324)
T cd05589         233 RRLLRRNPERRLGSGEKDAEDVKKQPFFRDINWDDLLARKIKPPFVPTI-----KGPEDVSNFDEEFTSEAPVLTPPREP  307 (324)
T ss_pred             HHHhhcCHhHcCCCCCCCHHHHhhCCCcCCCCHHHHHhCCCCcCccCCC-----CCcchhhhcCccccccccccCCCccc
Confidence            5677888888863    68999999999999999999999999999985     4455666666443221          


Q ss_pred             CCCChhhhcccCCcccC
Q psy10            68 IKLTEADQDLYKNFPLT   84 (100)
Q Consensus        68 ~~~~~~~~~~F~~Fsy~   84 (100)
                      ..+++..|..|.+|+|+
T Consensus       308 ~~~~~~~~~~~~~~~~~  324 (324)
T cd05589         308 RLLTEEEQELFRGFDYV  324 (324)
T ss_pred             cccchhhhcccCCcccC
Confidence            12567789999999985


No 20 
>KOG0603|consensus
Probab=98.98  E-value=2.3e-10  Score=86.27  Aligned_cols=84  Identities=23%  Similarity=0.453  Sum_probs=66.4

Q ss_pred             CccCCCCCccc----CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCCC-------C
Q psy10             3 KHKAKTPIQQQ----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKL-------T   71 (100)
Q Consensus         3 k~l~k~p~~r~----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~~-------~   71 (100)
                      ..+.++|.+|+    .|+.+|++|+||..|+|+.|..|++.|||+|.+     ....|+.+|+++++...+.       .
T Consensus       220 ~l~~r~p~nrLg~~~~~~~eik~h~f~~~i~~~~l~~r~~~~~fkp~~-----~~e~~~~~fd~eft~~~P~dsp~~~~~  294 (612)
T KOG0603|consen  220 QLFKRNPENRLGAGPDGVDEIKQHEFFQSIDWNELEARSRPPPFKPGS-----ITERDVAQFDPEFTSQVPADSPLLSAS  294 (612)
T ss_pred             HHHhhCHHHHhccCcchhHHHhccchheeeeHhhHhhcCCCCCCCCcc-----cchhhhhhcCchhccCCcccCCCCCCC
Confidence            34556666665    489999999999999999999999999999984     6678889999988765432       2


Q ss_pred             hhhhcccCCcccCCCHHHHH
Q psy10            72 EADQDLYKNFPLTISERLAE   91 (100)
Q Consensus        72 ~~~~~~F~~Fsy~~~~~~~~   91 (100)
                      ..++..|.||+|+++.-..+
T Consensus       295 ~s~~~if~g~sfva~~il~~  314 (612)
T KOG0603|consen  295 GSDHTIFSGPSFVAPGVLED  314 (612)
T ss_pred             ccccchhcCCCccChHHhhc
Confidence            34457899999987765544


No 21 
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=98.92  E-value=1.2e-09  Score=76.68  Aligned_cols=81  Identities=22%  Similarity=0.441  Sum_probs=60.7

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC---------CCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI---------KLT   71 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~---------~~~   71 (100)
                      |++.|.++|.+|..-.++|+.||||++++|..+..+.+.+|+.|..     ....+.++|+.+.....         ...
T Consensus       227 i~~~l~~dP~~R~~~~~~~~~h~~f~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (316)
T cd05620         227 LEKLFERDPTRRLGVVGNIRGHPFFKTINWTALEKRELDPPFKPKV-----KSPSDYSNFDREFLSEKPRLSYSDKNLID  301 (316)
T ss_pred             HHHHccCCHHHcCCChHHHHcCCCcCCCCHHHHHhCCCCCCcCCCC-----CCcchhhhcCccccccCcccCCCcccccc
Confidence            3567889999998777899999999999999999999999999975     34445555554333211         123


Q ss_pred             hhhhcccCCcccCCC
Q psy10            72 EADQDLYKNFPLTIS   86 (100)
Q Consensus        72 ~~~~~~F~~Fsy~~~   86 (100)
                      ..++..|+||+|..|
T Consensus       302 ~~~~~~~~~~~~~~~  316 (316)
T cd05620         302 SMDQSAFAGFSFINP  316 (316)
T ss_pred             cccccCcCCCcccCC
Confidence            456789999999754


No 22 
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=98.90  E-value=1.4e-09  Score=76.69  Aligned_cols=79  Identities=24%  Similarity=0.449  Sum_probs=57.9

Q ss_pred             CCCccCCCCCcccC-----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC-------
Q psy10             1 MPKHKAKTPIQQQL-----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI-------   68 (100)
Q Consensus         1 l~k~l~k~p~~r~~-----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~-------   68 (100)
                      |++.|.++|..|++     ++++|+.||||..++|+.+..+.+.||+.|.+     ....+..+|...+....       
T Consensus       236 i~~~L~~dP~~R~~~~~~~~~~~i~~hp~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~p~~  310 (329)
T cd05588         236 LKGFLNKDPKERLGCHPQTGFRDIKSHPFFRNIDWDLLEQKQVLPPYKPNI-----ESDRDLDNFDPQFTDEPVQLTPDD  310 (329)
T ss_pred             HHHHhccCHHHcCCCCCCCCHHHHhcCCCCCCCCHHHHHhCCCCCCccccC-----CCcchhhhcCCccccCccccCCCC
Confidence            35678889999974     58999999999999999999999999999975     34445455554332211       


Q ss_pred             --CCChhhhcccCCcccC
Q psy10            69 --KLTEADQDLYKNFPLT   84 (100)
Q Consensus        69 --~~~~~~~~~F~~Fsy~   84 (100)
                        .+...++..|.||.|.
T Consensus       311 ~~~~~~~~~~~~~~~~~~  328 (329)
T cd05588         311 PDVIARIDQSEFEGFEYI  328 (329)
T ss_pred             ccccccccccccCCCccc
Confidence              1234557889999885


No 23 
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=98.87  E-value=1.8e-09  Score=75.83  Aligned_cols=79  Identities=28%  Similarity=0.456  Sum_probs=58.8

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC----C----
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI----K----   69 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~----~----   69 (100)
                      ++.|.++|.+|+.    .+.+|++||||.+++|+.+..+.+.||+.|.+     .+..|..+|+++.+...    +    
T Consensus       227 ~~~L~~dP~~R~~~~~~~~~~ll~h~~f~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~p~~~~  301 (323)
T cd05571         227 AGLLKKDPKQRLGGGPEDAKEIMEHRFFASINWQDVVQKKLEPPFKPQV-----TSETDTRYFDEEFTAQSITITPPDRY  301 (323)
T ss_pred             HHHccCCHHHcCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCC-----CCcchhhhcCcccccCCcccCCCCcc
Confidence            4667888888874    78999999999999999999999999999975     45566667765443321    0    


Q ss_pred             --C---ChhhhcccCCcccCC
Q psy10            70 --L---TEADQDLYKNFPLTI   85 (100)
Q Consensus        70 --~---~~~~~~~F~~Fsy~~   85 (100)
                        .   .......|.+|+|.+
T Consensus       302 ~~~~~~~~~~~~~~~~~~~~~  322 (323)
T cd05571         302 DSLGLLQLEERPHFPQFSYSA  322 (323)
T ss_pred             cccccccccccccCCCCeeeC
Confidence              0   112356799999964


No 24 
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=98.86  E-value=2e-09  Score=76.47  Aligned_cols=75  Identities=20%  Similarity=0.414  Sum_probs=53.9

Q ss_pred             CCccCCCCCccc----CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC--CCChhhh
Q psy10             2 PKHKAKTPIQQQ----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI--KLTEADQ   75 (100)
Q Consensus         2 ~k~l~k~p~~r~----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~--~~~~~~~   75 (100)
                      ++.|.++|..|.    .++++|+.||||++++|..+..+.+.+|++|..     ....+.++|........  ......+
T Consensus       260 ~~~l~~dp~~R~~~~~~~~~~~~~hp~f~~~~~~~~~~~~~~~~~~p~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~  334 (340)
T PTZ00426        260 KKLLSHDLTKRYGNLKKGAQNVKEHPWFGNIDWVSLLHKNVEVPYKPKY-----KNVFDSSNFERVQEDLTIADKITNEN  334 (340)
T ss_pred             HHHcccCHHHcCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCC-----CCCcchhhcCCCcccccccCCCcccc
Confidence            467788888886    379999999999999999999999999999985     44556666654322221  1112345


Q ss_pred             cccCCc
Q psy10            76 DLYKNF   81 (100)
Q Consensus        76 ~~F~~F   81 (100)
                      +.|.||
T Consensus       335 ~~~~~~  340 (340)
T PTZ00426        335 DPFFDW  340 (340)
T ss_pred             CcccCC
Confidence            667665


No 25 
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=98.85  E-value=3.3e-09  Score=74.84  Aligned_cols=79  Identities=25%  Similarity=0.536  Sum_probs=56.8

Q ss_pred             CCCccCCCCCcccC-----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCC-CCCC---
Q psy10             1 MPKHKAKTPIQQQL-----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKG-IKLT---   71 (100)
Q Consensus         1 l~k~l~k~p~~r~~-----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~-~~~~---   71 (100)
                      |++.|.++|..|++     |+.+|++||||++++|+.+..+++.||+.|..     .+..+..+|++..+.. ..++   
T Consensus       236 l~~~L~~dP~~R~~~~~~~~~~~i~~hp~f~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~  310 (329)
T cd05618         236 LKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDLMEQKQVVPPFKPNI-----SGEFGLDNFDAQFTNEPVQLTPDD  310 (329)
T ss_pred             HHHHhcCCHHHcCCCCCCCCHHHHhcCCCCCCCCHHHHHcCCCCcCccCCC-----CCcccchhcCcccccCCccCCCCc
Confidence            35678888999974     57999999999999999999999999999985     3445555565433322 1111   


Q ss_pred             -----hhhhcccCCcccC
Q psy10            72 -----EADQDLYKNFPLT   84 (100)
Q Consensus        72 -----~~~~~~F~~Fsy~   84 (100)
                           ......|.||.|.
T Consensus       311 ~~~~~~~~~~~~~~~~~~  328 (329)
T cd05618         311 DDIVRKIDQSEFEGFEYI  328 (329)
T ss_pred             ccccccccccccCCCccc
Confidence                 1234678898875


No 26 
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=98.84  E-value=2.6e-09  Score=75.02  Aligned_cols=78  Identities=22%  Similarity=0.427  Sum_probs=57.1

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC---------
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI---------   68 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~---------   68 (100)
                      ++.|.++|..|.+    +.++|++||||++++|+.+..+.+.+|+.|.+     ....+.++|+.......         
T Consensus       233 ~~~l~~~P~~R~~~~~~~~~~~~~hp~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~  307 (324)
T cd05587         233 KGLLTKHPAKRLGCGPTGERDIREHAFFRRIDWEKLERREIQPPFKPKV-----KGRRSAENFDKFFTREPPVLTPPDKL  307 (324)
T ss_pred             HHHhhcCHHHcCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCccCcC-----CCcchhhhcCcccccCccccCCCCcc
Confidence            4667888999874    35899999999999999999999999999985     34455556664433211         


Q ss_pred             CCChhhhcccCCcccC
Q psy10            69 KLTEADQDLYKNFPLT   84 (100)
Q Consensus        69 ~~~~~~~~~F~~Fsy~   84 (100)
                      .+...++..|++|+|+
T Consensus       308 ~~~~~~~~~~~~~~~~  323 (324)
T cd05587         308 VIANIDQSEFQGFSFV  323 (324)
T ss_pred             ccccccccccCCCccc
Confidence            1223456789999986


No 27 
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=98.83  E-value=3.3e-09  Score=74.34  Aligned_cols=78  Identities=27%  Similarity=0.534  Sum_probs=56.5

Q ss_pred             CCccCCCCCcccC------ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC-------
Q psy10             2 PKHKAKTPIQQQL------RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI-------   68 (100)
Q Consensus         2 ~k~l~k~p~~r~~------g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~-------   68 (100)
                      ++.|.++|..|++      .+++|+.||||.+++|+.+..+.+.+|+.|...     ...+..+|+..++...       
T Consensus       228 ~~~L~~dp~~R~~~~~~~~~~~~~~~hp~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~  302 (321)
T cd05591         228 KAFMTKNPNKRLGCVASQGGEDAIKQHPFFKEIDWVLLEQRKIKPPFKPKIK-----TKRDVNNFDQDFTKEEPVLTPVD  302 (321)
T ss_pred             HHHhccCHHHcCCCCCCCCCHHHHhcCCccCCCCHHHHHhCCCCCCCCCCCC-----CcchhhhcCCccccCccccCCCC
Confidence            4678889999973      788999999999999999999999999999752     3334444543332211       


Q ss_pred             --CCChhhhcccCCcccC
Q psy10            69 --KLTEADQDLYKNFPLT   84 (100)
Q Consensus        69 --~~~~~~~~~F~~Fsy~   84 (100)
                        .+....++.|.||++.
T Consensus       303 ~~~~~~~~~~~~~~~~~~  320 (321)
T cd05591         303 PAVIKQINQEEFRGFSFF  320 (321)
T ss_pred             ccccccccccccCCCccc
Confidence              1223456789999984


No 28 
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=98.83  E-value=5.8e-09  Score=73.17  Aligned_cols=77  Identities=25%  Similarity=0.400  Sum_probs=54.8

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC---------
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI---------   68 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~---------   68 (100)
                      .++|.++|.+|.+    +..+|+.|+||+.++|+.+..+.++||+.|...      ..|..+++..+....         
T Consensus       233 ~~~l~~~p~~R~~~~~~~~~~i~~h~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~  306 (323)
T cd05616         233 KGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEVQPPYKPKAC------GRDAENFDKFFTRHPPVLTPPDQE  306 (323)
T ss_pred             HHHcccCHHhcCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCcCC------CchhhhcCchhccCCccCCCCCcc
Confidence            4567788888864    578999999999999999999999999999742      244444443333211         


Q ss_pred             CCChhhhcccCCcccC
Q psy10            69 KLTEADQDLYKNFPLT   84 (100)
Q Consensus        69 ~~~~~~~~~F~~Fsy~   84 (100)
                      .+...++..|+||+|+
T Consensus       307 ~~~~~~~~~~~~~~~~  322 (323)
T cd05616         307 VIMNLDQSEFEGFSYV  322 (323)
T ss_pred             ccccccccccCCCccc
Confidence            1112345789999996


No 29 
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=98.82  E-value=4.2e-09  Score=74.01  Aligned_cols=56  Identities=30%  Similarity=0.571  Sum_probs=45.2

Q ss_pred             CCccCCCCCcccC---ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCc
Q psy10             2 PKHKAKTPIQQQL---RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDE   62 (100)
Q Consensus         2 ~k~l~k~p~~r~~---g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~   62 (100)
                      ++.|.++|..|..   .+++++.||||++++|+.+..+.+.+|+.|..     ....+.++|+.
T Consensus       230 ~~~L~~~P~~R~~~~~~~~~ll~h~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~  288 (330)
T cd05586         230 KGLLNRNPQHRLGAHRDAVELKEHPFFADIDWDLLSKKQITPPFKPIV-----DSDEDVSNFDP  288 (330)
T ss_pred             HHHcCCCHHHCCCCCCCHHHHhcCccccCCCHHHHHhCCCCCCccCCC-----CCCcchhhcCc
Confidence            5678888999973   78999999999999999999999999999974     34445455543


No 30 
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=98.77  E-value=7.5e-09  Score=72.31  Aligned_cols=78  Identities=29%  Similarity=0.577  Sum_probs=60.8

Q ss_pred             CCCccCCCCCcccC--ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC---------C
Q psy10             1 MPKHKAKTPIQQQL--RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI---------K   69 (100)
Q Consensus         1 l~k~l~k~p~~r~~--g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~---------~   69 (100)
                      |++.|.++|.+|++  ++.++..||||..++|..+..+.+.+|+.|.+     .+..+.++|+++.+...         .
T Consensus       224 i~~~L~~dp~~R~~~~~~~e~l~hp~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~  298 (312)
T cd05585         224 LIGLLSRDPTRRLGYNGAQEIKNHPFFSQLSWKKLLMKGIQPPFKPAV-----SSAIDTSNFDEEFTREKPIDSVVDDSH  298 (312)
T ss_pred             HHHHcCCCHHHcCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCC-----CCccchhhcCccccccccccCCCcccc
Confidence            35678899999974  78999999999999999999999999999974     45667777776554322         1


Q ss_pred             CChhhhcccCCccc
Q psy10            70 LTEADQDLYKNFPL   83 (100)
Q Consensus        70 ~~~~~~~~F~~Fsy   83 (100)
                      +....|..|.+|+|
T Consensus       299 ~~~~~~~~~~~~~~  312 (312)
T cd05585         299 LSETVQQQFGGWSY  312 (312)
T ss_pred             ccchhccccCCCCC
Confidence            23445788999987


No 31 
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=98.76  E-value=1.6e-08  Score=71.06  Aligned_cols=77  Identities=23%  Similarity=0.441  Sum_probs=55.6

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC---------
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI---------   68 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~---------   68 (100)
                      ++.|.++|..|+.    +.++|+.||||++++|..+..+.+.+|+.|...      .....+|+...+...         
T Consensus       233 ~~~l~~~p~~R~~~~~~~~~~i~~h~~f~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~  306 (323)
T cd05615         233 KGLMTKHPSKRLGCGPEGERDIREHAFFRRIDWDKLENREIQPPFKPKVC------GKGAENFDKFFTRGQPVLTPPDQL  306 (323)
T ss_pred             HHHcccCHhhCCCCCCCCHHHHhcCcccCCCCHHHHhcCCCCcCccCccC------CCchhhcCccccccCCCCCCCccc
Confidence            3567788888873    578999999999999999999999999999742      133455554432210         


Q ss_pred             CCChhhhcccCCcccC
Q psy10            69 KLTEADQDLYKNFPLT   84 (100)
Q Consensus        69 ~~~~~~~~~F~~Fsy~   84 (100)
                      .+...+...|.+|+|+
T Consensus       307 ~~~~~~~~~~~~~~~~  322 (323)
T cd05615         307 VIANIDQADFEGFSYV  322 (323)
T ss_pred             ccccccccccCCCccc
Confidence            1223445789999996


No 32 
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=98.75  E-value=8.4e-09  Score=72.74  Aligned_cols=79  Identities=28%  Similarity=0.494  Sum_probs=58.1

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCC--------
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIK--------   69 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~--------   69 (100)
                      ++.|.++|..|..    .+.+|++|+||.+++|..+..+.+.||+.|..     .+..+...|+.+++....        
T Consensus       227 ~~~L~~dP~~R~~~~~~~~~~il~h~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (328)
T cd05593         227 SGLLIKDPNKRLGGGPDDAKEIMRHSFFTGVNWQDVYDKKLVPPFKPQV-----TSETDTRYFDEEFTAQTITITPPEKY  301 (328)
T ss_pred             HHHcCCCHHHcCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCcC-----CCcchhhhcCcccccCCcccCCcccc
Confidence            4677888888873    78999999999999999999999999999975     455565666655443211        


Q ss_pred             -------CChhhhcccCCcccCC
Q psy10            70 -------LTEADQDLYKNFPLTI   85 (100)
Q Consensus        70 -------~~~~~~~~F~~Fsy~~   85 (100)
                             ........|.+|+|.+
T Consensus       302 ~~~~~~~~~~~~~~~~~~~~~~~  324 (328)
T cd05593         302 DEDGMDCMDNERRPHFPQFSYSA  324 (328)
T ss_pred             ccccccccccccccccCCceeeC
Confidence                   1112246799999964


No 33 
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=98.75  E-value=9.8e-09  Score=72.12  Aligned_cols=79  Identities=30%  Similarity=0.595  Sum_probs=59.4

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCC------CCCC
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKG------IKLT   71 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~------~~~~   71 (100)
                      ++.|.++|..|..    .++++.+||||++++|+.+..+++.+|+.|..     ....+...|.++....      ....
T Consensus       243 ~~~l~~dp~~R~~~~~~~~~~~l~h~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (332)
T cd05614         243 HKLLRKDPKKRLGAGPQGASEIKEHPFFKGLDWEALALRKVNPPFRPSI-----RNELDVGNFAEEFTNLEPVYSPAGTP  317 (332)
T ss_pred             HHHcCCCHHHcCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCC-----CCcchhhhcCcccccCCcccCCCCCC
Confidence            4678888888873    78999999999999999999999999999974     4455555665543321      1223


Q ss_pred             hhhhcccCCcccCC
Q psy10            72 EADQDLYKNFPLTI   85 (100)
Q Consensus        72 ~~~~~~F~~Fsy~~   85 (100)
                      +.....|+||+|+.
T Consensus       318 ~~~~~~~~~~~~~~  331 (332)
T cd05614         318 PSGARVFQGYSFVA  331 (332)
T ss_pred             cccccccCCceecC
Confidence            45577999999974


No 34 
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=98.74  E-value=1.1e-08  Score=71.87  Aligned_cols=80  Identities=26%  Similarity=0.386  Sum_probs=55.5

Q ss_pred             CCccCCCCCccc---CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCC---------
Q psy10             2 PKHKAKTPIQQQ---LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIK---------   69 (100)
Q Consensus         2 ~k~l~k~p~~r~---~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~---------   69 (100)
                      +++|.++|..|.   ..+.+|+.||||++++|..+..+++.+|+.|..     ....+.++|+........         
T Consensus       228 ~~ll~~~p~~R~~~~~~~~~i~~h~~f~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~  302 (325)
T cd05604         228 EELLEKDRQRRLGAKEDFLEIQEHPFFESLSWTDLEQKKIPPPFNPNV-----EGPDDISNFDAVFTEETVPYSVCFSSD  302 (325)
T ss_pred             HHHhccCHHhcCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCcC-----CCcchhhhcCCccccCCcccCcccccc
Confidence            456777777776   357899999999999999999999999999975     344455555543222110         


Q ss_pred             ------CChhhhcccCCcccCCC
Q psy10            70 ------LTEADQDLYKNFPLTIS   86 (100)
Q Consensus        70 ------~~~~~~~~F~~Fsy~~~   86 (100)
                            ....-...|.||+|..|
T Consensus       303 ~~~~~~~~~~~~~~~~~~~~~~~  325 (325)
T cd05604         303 YSIVNASVLEADDAFVGFSYAPP  325 (325)
T ss_pred             cccccccccccccccCCCEecCC
Confidence                  01123467999999754


No 35 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=98.70  E-value=1.4e-08  Score=71.58  Aligned_cols=75  Identities=23%  Similarity=0.403  Sum_probs=55.3

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCcccc----CCCCCChh
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDT----KGIKLTEA   73 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~----~~~~~~~~   73 (100)
                      ++.|.++|..|+.    ++++|+.||||++++|+.+..+.+.+|+.+.+     ....+..+|.....    ....++..
T Consensus       247 ~~~L~~dP~~R~~~~~~~~~~ll~hp~f~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~s~~~~~~~~~~~  321 (329)
T PTZ00263        247 KGLLQTDHTKRLGTLKGGVADVKNHPYFHGANWDKLYARYYPAPIPVRV-----KSPGDTSNFEKYPDSPVDRLPPLTAA  321 (329)
T ss_pred             HHHhhcCHHHcCCCCCCCHHHHhcCCccCCCCHHHHHhCCCCCCcCCCC-----CCcccchhccCCcccccccCCCCchh
Confidence            4678888898874    68999999999999999999999999887764     34455566653221    12345566


Q ss_pred             hhcccCCc
Q psy10            74 DQDLYKNF   81 (100)
Q Consensus        74 ~~~~F~~F   81 (100)
                      .+..|.||
T Consensus       322 ~~~~~~~~  329 (329)
T PTZ00263        322 QQAEFAGF  329 (329)
T ss_pred             hhhhcCCC
Confidence            67788887


No 36 
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=98.63  E-value=2.8e-08  Score=69.75  Aligned_cols=78  Identities=24%  Similarity=0.402  Sum_probs=54.7

Q ss_pred             CCccCCCCCcccC---ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCC---------
Q psy10             2 PKHKAKTPIQQQL---RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIK---------   69 (100)
Q Consensus         2 ~k~l~k~p~~r~~---g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~---------   69 (100)
                      ++.|.++|..|..   .+.+|..||||.+++|+.+..+++.+|+.|.+     ....+..+|+..++....         
T Consensus       228 ~~~l~~~p~~R~~~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~  302 (323)
T cd05575         228 EGLLQKDRTKRLGAKDDFLEIKNHVFFSSINWDDLVNKKITPPFNPNV-----SGPMDLKHFDPEFTEEPVPNSVGKSPD  302 (323)
T ss_pred             HHHhhcCHHhCCCCCCCHHHHHcCCCcCCCCHHHHhhccCCCCcCCCC-----CCcchhhhcCccccccccccccCCCcc
Confidence            4567778888863   56899999999999999999999999999975     344455555543332110         


Q ss_pred             ------CChhhhcccCCcccC
Q psy10            70 ------LTEADQDLYKNFPLT   84 (100)
Q Consensus        70 ------~~~~~~~~F~~Fsy~   84 (100)
                            ........|.||+|.
T Consensus       303 ~~~~~~~~~~~~~~~~~~~~~  323 (323)
T cd05575         303 SVLVSASVKEADDAFLGFSYA  323 (323)
T ss_pred             cccccccccccccccCCCccC
Confidence                  112335679999883


No 37 
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=98.61  E-value=1e-08  Score=70.66  Aligned_cols=44  Identities=23%  Similarity=0.462  Sum_probs=39.7

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCC
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPP   45 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~   45 (100)
                      ++.|.++|..|++    ++++|++||||.+++|+.+.++.++|||+|.
T Consensus       237 ~~~l~~~P~~R~~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~  284 (285)
T cd05631         237 RMLLTKNPKERLGCRGNGAAGVKQHPIFKNINFKRLEANMLEPPFCPD  284 (285)
T ss_pred             HHHhhcCHHHhcCCCCCCHHHHhcCHhhcCCCHHHHHhCcCCcCCCCC
Confidence            4567888888874    6999999999999999999999999999995


No 38 
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=98.53  E-value=2e-07  Score=65.48  Aligned_cols=80  Identities=25%  Similarity=0.507  Sum_probs=56.5

Q ss_pred             CCccCCCCCccc----CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC--------C
Q psy10             2 PKHKAKTPIQQQ----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI--------K   69 (100)
Q Consensus         2 ~k~l~k~p~~r~----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~--------~   69 (100)
                      ++.|.++|..|.    ..+++++.||||+.++|+.+..+.+.+|+.+..     .+..+.+.|+..++...        .
T Consensus       232 ~~~l~~~p~~R~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~  306 (323)
T cd05584         232 KKLLKRNPSSRLGAGPGDAAEVQSHPFFRHVNWDDLLARKVEPPFKPLL-----QSEEDVSQFDSKFTRQTPVDSPDDST  306 (323)
T ss_pred             HHHcccCHhHcCCCCCCCHHHHhcCCCcCCCCHHHHhcCCCCCCcCCCC-----CCcchhhhcCchhcccccccCccccc
Confidence            456777777776    378999999999999999999999999998874     34445555554332211        1


Q ss_pred             CChhhhcccCCcccCCC
Q psy10            70 LTEADQDLYKNFPLTIS   86 (100)
Q Consensus        70 ~~~~~~~~F~~Fsy~~~   86 (100)
                      ........|.||+|.++
T Consensus       307 ~~~~~~~~~~~~~~~~~  323 (323)
T cd05584         307 LSESANQIFLGFTYVAP  323 (323)
T ss_pred             cccccccCcCCCeecCC
Confidence            22233568999999753


No 39 
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=98.53  E-value=8.8e-08  Score=67.27  Aligned_cols=56  Identities=27%  Similarity=0.450  Sum_probs=43.8

Q ss_pred             CCccCCCCCcccC---ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCc
Q psy10             2 PKHKAKTPIQQQL---RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDE   62 (100)
Q Consensus         2 ~k~l~k~p~~r~~---g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~   62 (100)
                      ++.|.++|..|..   .+.+|++|+||..++|+.+..+++.+|+.|..     ....+..+|+.
T Consensus       228 ~~~l~~~p~~R~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~  286 (325)
T cd05602         228 EGLLQKDRTKRLGAKDDFMEIKNHIFFSPINWDDLINKKITPPFNPNV-----SGPNDLRHFDP  286 (325)
T ss_pred             HHHcccCHHHCCCCCCCHHHHhcCcccCCCCHHHHHhCCCCcCcCCCC-----CCcchhhhcCC
Confidence            4677888888873   56799999999999999999999999999875     33344445543


No 40 
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=98.53  E-value=8.1e-08  Score=67.70  Aligned_cols=75  Identities=27%  Similarity=0.556  Sum_probs=53.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC----------CCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI----------KLT   71 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~----------~~~   71 (100)
                      ++++. +|..|...+++|..||||++++|+.+.  ...||++|.+     .+..+..+|+.......          ...
T Consensus       266 ~~ll~-dp~~R~~s~~~ll~hp~~~~~~~~~~~--~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  337 (350)
T cd05573         266 CRLLC-DPEDRLGSFEEIKSHPFFKGIDWENLR--ETKPPFVPEL-----SSPLDTSNFDDFEDDKDLSDYLSQNSKKLN  337 (350)
T ss_pred             HHHcc-ChhhcCCCHHHHhcCCCcCCCCHHHHh--hCCCCcCCCC-----CCchhhhhcCCCCccccccccccccccccc
Confidence            34565 899998779999999999999999877  5678899975     44455555554332211          122


Q ss_pred             hhhhcccCCcccC
Q psy10            72 EADQDLYKNFPLT   84 (100)
Q Consensus        72 ~~~~~~F~~Fsy~   84 (100)
                      ...+..|.||+|.
T Consensus       338 ~~~~~~~~~~~~~  350 (350)
T cd05573         338 KGKQLAFVGFTYK  350 (350)
T ss_pred             ccccCccCCCccC
Confidence            3456789999984


No 41 
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=98.52  E-value=9.2e-08  Score=67.25  Aligned_cols=79  Identities=28%  Similarity=0.462  Sum_probs=57.2

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC-CCCh----
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI-KLTE----   72 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~-~~~~----   72 (100)
                      ++.|.++|..|++    .+.+|+.|+||.+++|..+..+.+.||+.|..     .+..+...|+.+.+... ...+    
T Consensus       227 ~~~L~~dP~~R~~~~~~~~~~~l~h~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (323)
T cd05595         227 AGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQV-----TSEVDTRYFDDEFTAQSITITPPDRY  301 (323)
T ss_pred             HHHccCCHHHhCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCC-----CChhhhhhcCcccccCCccCCCCccc
Confidence            4677888888873    78999999999999999999999999999975     45566666665554321 1111    


Q ss_pred             --------hhhcccCCcccCC
Q psy10            73 --------ADQDLYKNFPLTI   85 (100)
Q Consensus        73 --------~~~~~F~~Fsy~~   85 (100)
                              .--..|.+|||.+
T Consensus       302 ~~~~~~~~~~~~~~~~~~~~~  322 (323)
T cd05595         302 DSLGLLELDQRTHFPQFSYSA  322 (323)
T ss_pred             ccccccccccccccCCCcccC
Confidence                    1124799999864


No 42 
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=98.50  E-value=1e-07  Score=66.63  Aligned_cols=79  Identities=28%  Similarity=0.560  Sum_probs=54.2

Q ss_pred             CCCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCC-------CC
Q psy10             1 MPKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKG-------IK   69 (100)
Q Consensus         1 l~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~-------~~   69 (100)
                      |++.|.++|..|..    .+++++.|+||..++|..+..+++.||+.|...     ...+...++......       .+
T Consensus       229 i~~~l~~~P~~R~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~  303 (318)
T cd05582         229 LRALFKRNPANRLGAGPDGVEEIKRHPFFSTIDWNKLYRREIKPPFKPAVG-----RPDDTFYFDPEFTSRTPKDSPGIP  303 (318)
T ss_pred             HHHHhhcCHhHcCCCCCCCHHHHhCCCCcCCCCHHHHHhcCCCCCcCCCCC-----CcchhhhcCcccccCccccCCCCc
Confidence            35678888888874    388999999999999999999999999998742     222333333222111       12


Q ss_pred             CChhhhcccCCcccC
Q psy10            70 LTEADQDLYKNFPLT   84 (100)
Q Consensus        70 ~~~~~~~~F~~Fsy~   84 (100)
                      .+......|.||+|+
T Consensus       304 ~s~~~~~~~~~~~~~  318 (318)
T cd05582         304 PSANAHQLFRGFSFV  318 (318)
T ss_pred             cccccccccCCCEeC
Confidence            233456789999984


No 43 
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=98.49  E-value=7.4e-08  Score=66.63  Aligned_cols=57  Identities=28%  Similarity=0.549  Sum_probs=47.7

Q ss_pred             CCCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCc
Q psy10             1 MPKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDE   62 (100)
Q Consensus         1 l~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~   62 (100)
                      |++.|.++|.+|.+    .+++++.||||..++|..+..+++.||..|.+     ....|+.+|+.
T Consensus       229 i~~~l~~dp~~R~~~~~~~~~~~l~h~~~~~~~~~~~~~~~~~~~~~p~~-----~~~~~~~~~~~  289 (291)
T cd05612         229 IKKLLVVDRTRRLGNMKNGADDVKNHRWFKSVDWDDVPQRKLKPPIVPKV-----SHDGDTSNFDD  289 (291)
T ss_pred             HHHHcCCCHHHccCCccCCHHHHhcCccccCCCHHHHhcCCCCCCEeCCC-----CCccccccccC
Confidence            35678888998875    79999999999999999999999999999985     45666667653


No 44 
>KOG0592|consensus
Probab=98.45  E-value=5.2e-08  Score=73.07  Aligned_cols=42  Identities=36%  Similarity=0.804  Sum_probs=34.1

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIP   44 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P   44 (100)
                      ++|+|.++|..|+ ++++||+||||.+|||+.|.+.. +|+..|
T Consensus       318 v~KLLv~dp~~Rl-t~~qIk~HpFF~~Vdw~nlw~~~-PP~l~p  359 (604)
T KOG0592|consen  318 IKKLLVRDPSDRL-TSQQIKAHPFFEGVDWENLWQQT-PPKLQP  359 (604)
T ss_pred             HHHHHccCccccc-cHHHHhhCcccccCChhhhhhcC-CCcccC
Confidence            3689999999998 67999999999999999987743 333444


No 45 
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=98.29  E-value=8.8e-07  Score=62.04  Aligned_cols=58  Identities=29%  Similarity=0.462  Sum_probs=44.6

Q ss_pred             CCccCCCCCcccC---ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccc
Q psy10             2 PKHKAKTPIQQQL---RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEED   64 (100)
Q Consensus         2 ~k~l~k~p~~r~~---g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~   64 (100)
                      .+.|.++|..|.+   .+.+|++|+||..++|+.+..+.+.||+.|..     ....+...++..+
T Consensus       228 ~~~l~~~p~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~  288 (321)
T cd05603         228 VGLLHKDQRRRLGAKADFLEIKNHVFFSPINWDDLYHKRITPPYNPNV-----AGPADLRHFDPEF  288 (321)
T ss_pred             HHHccCCHhhcCCCCCCHHHHhCCCCcCCCCHHHHhcCCCCCCcCCCC-----CCcchhhhcCCcc
Confidence            4677888888863   56799999999999999999999999998874     3444444555433


No 46 
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=98.28  E-value=7.3e-07  Score=62.60  Aligned_cols=59  Identities=36%  Similarity=0.583  Sum_probs=47.4

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCcccc
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDT   65 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~   65 (100)
                      ++.|.++|..|+.    .+.+|..|+||.++.|..+..+.+.||+.|..     .+..+...|++..+
T Consensus       228 ~~~L~~dP~~R~~~~~~~~~~il~h~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~  290 (325)
T cd05594         228 SGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEKKLVPPFKPQV-----TSETDTRYFDEEFT  290 (325)
T ss_pred             HHHhhcCHHHhCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCcC-----CCcchhhhcCchhh
Confidence            4677888999873    68999999999999999999999999999874     45556666665543


No 47 
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=98.28  E-value=7.4e-07  Score=63.35  Aligned_cols=74  Identities=20%  Similarity=0.435  Sum_probs=49.6

Q ss_pred             CccCCCCCcccC--ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC----------CC
Q psy10             3 KHKAKTPIQQQL--RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI----------KL   70 (100)
Q Consensus         3 k~l~k~p~~r~~--g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~----------~~   70 (100)
                      +++. +|..|+.  ++.++..||||++++|+.+..  ..+|++|..     .+..|.++|+.......          ..
T Consensus       276 ~ll~-~p~~R~~~~~~~~ll~h~~~~~~~~~~~~~--~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  347 (364)
T cd05599         276 RLCC-EAERRLGNNGVNEIKSHPFFKGVDWEHIRE--RPAPIIPEL-----KSITDTSNFDDFEEIDLDVPTSPGPPRGK  347 (364)
T ss_pred             HHcc-CHhhcCCCCCHHHHhcCCCcCCCCHHHHhh--cCCCCCCCC-----CCchhhhhccccccccccccCCCcccccc
Confidence            4443 7888886  899999999999999998764  578888875     34455555553221110          11


Q ss_pred             ChhhhcccCCcccC
Q psy10            71 TEADQDLYKNFPLT   84 (100)
Q Consensus        71 ~~~~~~~F~~Fsy~   84 (100)
                      ....+-.|.||+|.
T Consensus       348 ~~~~~~~~~~~~~~  361 (364)
T cd05599         348 IKSKDLAFIGYTYK  361 (364)
T ss_pred             ccccCCCCCCCeee
Confidence            12345578888885


No 48 
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=98.27  E-value=1.1e-06  Score=63.03  Aligned_cols=52  Identities=29%  Similarity=0.541  Sum_probs=40.4

Q ss_pred             cCCCCCcccC--ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCc
Q psy10             5 KAKTPIQQQL--RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDE   62 (100)
Q Consensus         5 l~k~p~~r~~--g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~   62 (100)
                      +.++|..|++  ++++|+.||||++++|..... +..+|++|.+     ....|.++|+.
T Consensus       286 l~~~p~~R~~~~~~~ei~~hp~f~~~~~~~~~~-~~~~~~~~~~-----~~~~~~~~~~~  339 (382)
T cd05625         286 LCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLR-QQSAPYIPKI-----THPTDTSNFDP  339 (382)
T ss_pred             HccCHhHcCCCCCHHHHhcCCCcCCcChHHHHh-cCCCCccCcC-----CCcchhhhcCC
Confidence            3468888875  799999999999999998654 5788999985     45566666654


No 49 
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=98.26  E-value=2.7e-07  Score=63.65  Aligned_cols=44  Identities=27%  Similarity=0.484  Sum_probs=38.3

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCC
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPP   45 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~   45 (100)
                      ++.|..+|..|++    +++++.+||||+.++|..+...++.|||+|.
T Consensus       237 ~~~l~~~p~~R~s~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~  284 (285)
T cd05630         237 KMLLCKDPKERLGCQGGGAREVKEHPLFKQINFKRLEAGMLEPPFKPD  284 (285)
T ss_pred             HHHhhcCHHHccCCCCCchHHHHcChhhhccCHHHHhcCCCCCCCCCC
Confidence            4567777777764    6999999999999999999999999999995


No 50 
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=98.23  E-value=1.2e-06  Score=62.95  Aligned_cols=77  Identities=21%  Similarity=0.408  Sum_probs=51.2

Q ss_pred             CCccCCCCCc--ccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCC-------C-CC
Q psy10             2 PKHKAKTPIQ--QQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGI-------K-LT   71 (100)
Q Consensus         2 ~k~l~k~p~~--r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~-------~-~~   71 (100)
                      ++.|..+|..  | .++++|+.||||++.+|.....+...+|++|..     .+..+.++|++......       + ..
T Consensus       283 ~~~L~~~p~r~~R-~s~~ell~h~~~~~~~~~~~~~~~~~~~~~p~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~  356 (370)
T cd05596         283 CAFLTDREVRLGR-NGVDEIKSHPFFKNDQWTFDNIRETVAPVVPEL-----SSDIDTSNFDDIEDDDKNEETFPLPKAF  356 (370)
T ss_pred             HHHccChhhccCC-CCHHHHhcCcccCCCChhhHHhcCCCcCccCcC-----CCcchhhhcCCccccccccccCCCcccc
Confidence            4566666654  3 378999999999999999888888889999985     34455555554322210       0 11


Q ss_pred             hhhhcccCCcccC
Q psy10            72 EADQDLYKNFPLT   84 (100)
Q Consensus        72 ~~~~~~F~~Fsy~   84 (100)
                      ...+..|.||+|.
T Consensus       357 ~~~~~~~~~~~~~  369 (370)
T cd05596         357 AGNQLPFIGFTYS  369 (370)
T ss_pred             ccccCccCCCeec
Confidence            1224459999884


No 51 
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=98.23  E-value=4.5e-07  Score=62.47  Aligned_cols=44  Identities=27%  Similarity=0.462  Sum_probs=38.9

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCC
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPP   45 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~   45 (100)
                      ++.+.++|..|.+    ++++++.|+||..++|..+.++.+.|||.|.
T Consensus       237 ~~~l~~~P~~R~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  284 (285)
T cd05605         237 RQLLTKDPGFRLGCRGEGAEEVKAHPFFRTANFKRLEAGMLEPPFCPD  284 (285)
T ss_pred             HHHccCCHHHhcCCCCCCHHHHhcCcCccCCCHHHHhhCCCCCCCCCC
Confidence            4567788888874    8899999999999999999999999999984


No 52 
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=98.23  E-value=4.3e-07  Score=62.34  Aligned_cols=45  Identities=22%  Similarity=0.458  Sum_probs=38.7

Q ss_pred             CCCccCCCCCcccCC---hhhhhcCCCCCCCChhHHhcCcCCCCccCC
Q psy10             1 MPKHKAKTPIQQQLR---SDEVKEHPFFTGLDWTQVYMQKYTPPLIPP   45 (100)
Q Consensus         1 l~k~l~k~p~~r~~g---~~eIk~HpfF~~idW~~l~~k~~~pP~~P~   45 (100)
                      |++.|.++|.+|.+.   .++++.|+||++++|..+..+.+.|||+|.
T Consensus       230 i~~~L~~~P~~R~~~~~~~~~~~~h~~f~~~~~~~~~~~~~~~~~~~~  277 (277)
T cd05607         230 CRLFLAKKPEDRLGSREKNDDPRKHEFFKTINFPRLEAGLIPPPFVPD  277 (277)
T ss_pred             HHHHhccCHhhCCCCccchhhhhcChhhcCCCHHHHhcCcCCCCCCCC
Confidence            356788899999754   478999999999999999999999999873


No 53 
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=98.22  E-value=1.4e-06  Score=62.10  Aligned_cols=49  Identities=29%  Similarity=0.518  Sum_probs=36.2

Q ss_pred             CCCCcccC--ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCc
Q psy10             7 KTPIQQQL--RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDE   62 (100)
Q Consensus         7 k~p~~r~~--g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~   62 (100)
                      .+|..|++  ++++|+.||||++++|+.+..+...+|+..       .+..|.++|+.
T Consensus       276 ~~p~~R~~~~~~~ei~~hp~f~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~  326 (360)
T cd05627         276 TDSENRIGSNGVEEIKSHPFFEGVDWGHIRERPAAIPIEI-------KSIDDTSNFDE  326 (360)
T ss_pred             cChhhcCCCCCHHHHhcCCCCCCCCHHHHhcCCCCCCccC-------CCcchhhhcCC
Confidence            47888874  789999999999999999988776665432       34445555553


No 54 
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=98.21  E-value=4.1e-07  Score=62.54  Aligned_cols=43  Identities=30%  Similarity=0.626  Sum_probs=37.6

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccC
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIP   44 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P   44 (100)
                      ++.|.++|..|++    .++++.+||||++++|..+.++.+.+||.|
T Consensus       233 ~~~l~~~P~~R~~~~~~~~~~~l~h~~~~~~~~~~~~~~~~~~~~~~  279 (280)
T cd05608         233 EALLAKDPEKRLGFRDGNCDGLRTHPLFRDLNWRQLEAGMLPPPFVP  279 (280)
T ss_pred             HHHhcCCHHHhcCCCCCCHHHHhcChhhhcCCHhHHhhccCCCCCCC
Confidence            4567788888873    689999999999999999999999999988


No 55 
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=98.21  E-value=1.7e-06  Score=61.70  Aligned_cols=48  Identities=27%  Similarity=0.479  Sum_probs=33.4

Q ss_pred             CCCccc--CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCc
Q psy10             8 TPIQQQ--LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDE   62 (100)
Q Consensus         8 ~p~~r~--~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~   62 (100)
                      ++..|+  .++++|++||||++++|+.+..+...+|+..       .+..|.++|+.
T Consensus       277 ~~~~r~~r~~~~ei~~hp~f~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~  326 (363)
T cd05628         277 EWEHRIGAPGVEEIKTNPFFEGVDWEHIRERPAAIPIEI-------KSIDDTSNFDE  326 (363)
T ss_pred             ChhhcCCCCCHHHHhCCCCCCCCCHHHHHhCCCCCCccC-------CCcchhhccCC
Confidence            445554  3789999999999999999988765555422       34445555554


No 56 
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=98.16  E-value=2.1e-06  Score=61.71  Aligned_cols=43  Identities=28%  Similarity=0.618  Sum_probs=33.9

Q ss_pred             CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCc
Q psy10            14 LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDE   62 (100)
Q Consensus        14 ~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~   62 (100)
                      .++.+|++||||.+++|..... ...+|++|.+     ....++++|+.
T Consensus       297 ~~~~~~l~hp~f~~~~~~~~~~-~~~~~~~p~~-----~~~~~~~~~~~  339 (381)
T cd05626         297 NGADDIKAHPFFSEVDFSSDIR-TQPAPYVPKI-----SHPMDTSNFDP  339 (381)
T ss_pred             CCHHHHhcCcccCCCChhHHhh-cCCCCccCcC-----CCcchhhhcCC
Confidence            3789999999999999998764 5778999985     45566666654


No 57 
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=98.14  E-value=2.1e-06  Score=61.44  Aligned_cols=52  Identities=27%  Similarity=0.572  Sum_probs=39.2

Q ss_pred             CccCCCCCccc--CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCc
Q psy10             3 KHKAKTPIQQQ--LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDE   62 (100)
Q Consensus         3 k~l~k~p~~r~--~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~   62 (100)
                      ++|. +|..|+  .++.+++.||||++++|+.+  +.+.+|++|..     ....+..+|..
T Consensus       285 ~lL~-~~~~r~~r~~~~~~l~hp~~~~~~~~~~--~~~~~~~~~~~-----~~~~~~~~~~~  338 (377)
T cd05629         285 RLIT-NAENRLGRGGAHEIKSHPFFRGVDWDTI--RQIRAPFIPQL-----KSITDTSYFPT  338 (377)
T ss_pred             HHhc-CHhhcCCCCCHHHHhcCCCcCCCCHHHH--ccCCCCcccCC-----CCccccccCCc
Confidence            4554 677775  48899999999999999998  46889999985     34455555543


No 58 
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=98.13  E-value=1.6e-06  Score=59.78  Aligned_cols=55  Identities=25%  Similarity=0.530  Sum_probs=45.7

Q ss_pred             CCccCCCCCccc----CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCC
Q psy10             2 PKHKAKTPIQQQ----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFD   61 (100)
Q Consensus         2 ~k~l~k~p~~r~----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~   61 (100)
                      ++.+.++|..|.    ..++|+..||||+.++|..+....+.+|+.|..     .+..|.+.|+
T Consensus       230 ~~~l~~~p~~R~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~  288 (290)
T cd05580         230 RNLLQVDLTKRLGNLKNGVNDIKNHPWFAGIDWIALLQRKIEAPFIPKV-----KGPGDTSNFD  288 (290)
T ss_pred             HHHccCCHHHccCcccCCHHHHHcCcccccCCHHHHhhccCCCCccCCC-----CCcccccccc
Confidence            466778888886    378999999999999999999999999999985     4556666665


No 59 
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=98.12  E-value=2.6e-06  Score=59.77  Aligned_cols=52  Identities=25%  Similarity=0.502  Sum_probs=39.5

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCc
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDE   62 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~   62 (100)
                      +++|. +|..|. ++++|+.||||+.++|+.+..  ..||++|..     ....|.++|.+
T Consensus       245 ~~ll~-~p~~R~-t~~~l~~h~~~~~~~~~~~~~--~~~~~~~~~-----~~~~~~~~~~~  296 (330)
T cd05601         245 QSLLC-GQKERL-GYEGLCCHPFFSKIDWNNIRN--SLPPFVPTL-----KSDDDTSNFDE  296 (330)
T ss_pred             HHHcc-ChhhCC-CHHHHhCCCCcCCCCHHHHhh--CCCCccCcC-----CCcchhhhcCC
Confidence            34565 888887 689999999999999998865  668888874     34455556654


No 60 
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=98.06  E-value=4.4e-06  Score=60.10  Aligned_cols=66  Identities=21%  Similarity=0.459  Sum_probs=44.7

Q ss_pred             CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCC-----CCC---ChhhhcccCCcccC
Q psy10            14 LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKG-----IKL---TEADQDLYKNFPLT   84 (100)
Q Consensus        14 ~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~-----~~~---~~~~~~~F~~Fsy~   84 (100)
                      .++.+++.||||++..|+....+...+|+.|.+     ....|.++|+......     .+.   ....+..|.||+|.
T Consensus       296 ~~~~e~l~hp~~~~~~~~~~~~~~~~~~~~p~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  369 (370)
T cd05621         296 NGVEEIKQHPFFKNDQWNWDNIRETAAPVVPEL-----SSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYY  369 (370)
T ss_pred             CCHHHHhcCcccCCCCcChHhcCCCCCCcCCCC-----CCcchhhhcCCccccccccccCCCCccccccccccCCCEec
Confidence            378999999999998877666677889999985     4555566665322211     011   11235789999984


No 61 
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=98.05  E-value=1.5e-06  Score=59.62  Aligned_cols=43  Identities=35%  Similarity=0.747  Sum_probs=37.9

Q ss_pred             CCccCCCCCccc--CChhhhhcCCCCCCCChhHHhcCcCCCCccC
Q psy10             2 PKHKAKTPIQQQ--LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIP   44 (100)
Q Consensus         2 ~k~l~k~p~~r~--~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P   44 (100)
                      ++.+.++|..|.  .++.++++||||+.++|+.+.++.+.|||.|
T Consensus       244 ~~~l~~~p~~R~t~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  288 (288)
T cd05583         244 QKLLEKDPKKRLGANGADEIKNHPFFQGIDWDDLAAKRIPAPFKP  288 (288)
T ss_pred             HHHhcCCHhhccCcchHHHHhcCcccccCCHHHHhhhccCCCCCC
Confidence            466788899986  4789999999999999999999999999875


No 62 
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=97.98  E-value=3e-06  Score=58.28  Aligned_cols=44  Identities=50%  Similarity=0.913  Sum_probs=37.7

Q ss_pred             CCccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCC
Q psy10             2 PKHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPP   45 (100)
Q Consensus         2 ~k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~   45 (100)
                      ++.|.++|.+|..    .+++|++||||++++|..+...+..+|-+|.
T Consensus       231 ~~~l~~~p~~R~~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~  278 (279)
T cd05633         231 EGLLQRDVSKRLGCLGRGAQEVKEHVFFKGIDWQQVYLQKYPPPLIPP  278 (279)
T ss_pred             HHHhcCCHHHhcCCCCCCHHHHHhCccccCCCHhHHhcCCCCCCCCCC
Confidence            4567888888874    7999999999999999999988888887774


No 63 
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=97.86  E-value=1.9e-05  Score=56.78  Aligned_cols=76  Identities=17%  Similarity=0.316  Sum_probs=47.0

Q ss_pred             CccCCCCCccc--CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCC---C--CCC---h
Q psy10             3 KHKAKTPIQQQ--LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKG---I--KLT---E   72 (100)
Q Consensus         3 k~l~k~p~~r~--~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~---~--~~~---~   72 (100)
                      +.|. ++..|+  .++++|++|+||++..|+....+...+|++|..     .+..+.++|++.....   .  ...   .
T Consensus       284 ~~L~-~~~~r~~r~~~~ei~~h~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  357 (371)
T cd05622         284 AFLT-DREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDL-----SSDIDTSNFDDIEEDKGEEETFPIPKAFV  357 (371)
T ss_pred             HHcC-ChhhhcCCCCHHHHhcCcccCCCChhHHhcCCCCCCCCCCC-----CCcchhhhcCCCcccccccccCCCCcccc
Confidence            3444 444443  478999999999998777666678889999974     3445555554321110   0  011   1


Q ss_pred             hhhcccCCcccC
Q psy10            73 ADQDLYKNFPLT   84 (100)
Q Consensus        73 ~~~~~F~~Fsy~   84 (100)
                      ..+..|.||+|.
T Consensus       358 ~~~~~~~~~~~~  369 (371)
T cd05622         358 GNQLPFVGFTYY  369 (371)
T ss_pred             ccccccCCCeec
Confidence            123689999985


No 64 
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=97.79  E-value=1.8e-05  Score=54.09  Aligned_cols=43  Identities=35%  Similarity=0.683  Sum_probs=36.5

Q ss_pred             CCccCCCCCccc----CChhhhhcCCCCCCCChhHHhcCcCCCCccC
Q psy10             2 PKHKAKTPIQQQ----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIP   44 (100)
Q Consensus         2 ~k~l~k~p~~r~----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P   44 (100)
                      ++.|..+|..|.    ..+.++..||||+.++|..+.+-..+|||.|
T Consensus       230 ~~~l~~~p~~R~~~~~~~~~~ll~h~~~~~~~~~~~~~~~~~~~~~~  276 (277)
T cd05577         230 EALLQKDPEKRLGCRGGSADEVREHPLFKDLNWRRLEAGMLEPPFIP  276 (277)
T ss_pred             HHHccCChhHccCCCcccHHHHHhChhhhcCChhhhhcCCCCCCCCC
Confidence            455667777776    3788999999999999999998889999987


No 65 
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=97.78  E-value=3.6e-05  Score=54.25  Aligned_cols=31  Identities=39%  Similarity=0.851  Sum_probs=26.9

Q ss_pred             CChhhhhcCCCCCCCChhHHhcCcCCCCccCCC
Q psy10            14 LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPR   46 (100)
Q Consensus        14 ~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~   46 (100)
                      .++++++.||||.+++|+.+..  ..+|++|..
T Consensus       258 ~~~~~~~~h~~f~~~~~~~~~~--~~~~~~~~~  288 (332)
T cd05623         258 NGIEDFKQHPFFTGIDWDNIRN--CEAPYIPEV  288 (332)
T ss_pred             CCHHHHhCCCCcCCCCHHHHhh--CCCCccCCC
Confidence            4789999999999999999865  678888874


No 66 
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=97.78  E-value=1.8e-05  Score=54.44  Aligned_cols=43  Identities=30%  Similarity=0.575  Sum_probs=37.0

Q ss_pred             CccCCCCCcccC----ChhhhhcCCCCCCCChhHHhcCcCCCCccCC
Q psy10             3 KHKAKTPIQQQL----RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPP   45 (100)
Q Consensus         3 k~l~k~p~~r~~----g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~   45 (100)
                      +.+.++|..|.+    ++.++..|+||+.++|+++.++++.|||+|.
T Consensus       238 ~~l~~~P~~R~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  284 (285)
T cd05632         238 MLLTKDPKQRLGCQEEGAGEVKRHPFFRNMNFKRLEAGMLDPPFVPD  284 (285)
T ss_pred             HHccCCHhHcCCCcccChHHHHcChhhhcCCHHHHhcCcCCCCCCCC
Confidence            456667777763    6899999999999999999999999999995


No 67 
>KOG0606|consensus
Probab=97.74  E-value=6.8e-06  Score=65.95  Aligned_cols=75  Identities=24%  Similarity=0.378  Sum_probs=54.3

Q ss_pred             CCccCCCCCccc--CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCccccCCCCC------Chh
Q psy10             2 PKHKAKTPIQQQ--LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKL------TEA   73 (100)
Q Consensus         2 ~k~l~k~p~~r~--~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~~~~~~------~~~   73 (100)
                      .++|..+|..|+  +|+-+||.|.||.++||..|+.++  ++|+|.+     .+..|+++|+...++....      +..
T Consensus       293 ~~LL~qnp~~Rlgt~ga~evk~h~ff~~LDw~~llRqk--aefvpql-----~~eddtsyfdTRs~Ryh~~~se~~~~ee  365 (1205)
T KOG0606|consen  293 EQLLRQNPLCRLGTGGALEVKQHGFFQLLDWKSLLRQK--AEFVPQL-----ESEDDTSYFDTRSDRYHHFESEDTGDEE  365 (1205)
T ss_pred             HHHHHhChHhhcccchhhhhhhccceeecccchhhhhh--ccccccc-----cccccchhhcccchheeeccccCCcccc
Confidence            457888899997  588899999999999999998866  8899995     5667788887544333211      112


Q ss_pred             hhcccCCccc
Q psy10            74 DQDLYKNFPL   83 (100)
Q Consensus        74 ~~~~F~~Fsy   83 (100)
                      ....|.+|+-
T Consensus       366 s~~~~~qFss  375 (1205)
T KOG0606|consen  366 SSLEFRQFSS  375 (1205)
T ss_pred             cccccccccc
Confidence            2236777764


No 68 
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=97.70  E-value=6.7e-05  Score=52.93  Aligned_cols=41  Identities=29%  Similarity=0.650  Sum_probs=30.6

Q ss_pred             CccCCCCCccc--CChhhhhcCCCCCCCChhHHhcCcCCCCccCCC
Q psy10             3 KHKAKTPIQQQ--LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPR   46 (100)
Q Consensus         3 k~l~k~p~~r~--~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~   46 (100)
                      ++|+. +..|.  .++++++.||||.+++|+.+..  ..+|++|..
T Consensus       246 ~ll~~-~~~r~~r~~~~~~l~hp~~~~~~~~~~~~--~~~~~~~~~  288 (331)
T cd05597         246 RLICS-PETRLGRNGLQDFKDHPFFEGIDWDNIRN--STAPYVPEV  288 (331)
T ss_pred             HHccC-cccccCCCCHHHHhcCCCCCCCCHHHHhh--CCCCccCcC
Confidence            34443 44443  3789999999999999998864  578888874


No 69 
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=97.60  E-value=8.3e-05  Score=53.20  Aligned_cols=50  Identities=30%  Similarity=0.586  Sum_probs=38.9

Q ss_pred             CCCCCcccC--ChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCC
Q psy10             6 AKTPIQQQL--RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFD   61 (100)
Q Consensus         6 ~k~p~~r~~--g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~   61 (100)
                      ..+|..|++  .+.++++||||++++|..+. ++..+|++|.+     ....+.++|+
T Consensus       283 ~~~p~~R~~~~t~~ell~h~~~~~~~~~~~~-~~~~~~~~~~~-----~~~~~~~~~~  334 (376)
T cd05598         283 CCGAEDRLGKNGADEIKAHPFFKGIDFASLI-RRQKAPYIPKI-----THPTDTSNFD  334 (376)
T ss_pred             hcCHhhcCCCCCHHHHhCCCCcCCCCHHHHh-hcCCCCCCCcC-----CCcchhhhcC
Confidence            458888874  68999999999999999887 66888999975     3344444444


No 70 
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=97.51  E-value=6.7e-05  Score=52.78  Aligned_cols=42  Identities=26%  Similarity=0.625  Sum_probs=33.4

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPR   46 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~   46 (100)
                      ++.|..+|..| ..+++|+.||||++++|+.+.  ...||++|..
T Consensus       238 ~~~l~~~~~rr-~s~~~ll~h~~~~~~~~~~~~--~~~~~~~~~~  279 (333)
T cd05600         238 TKLINDPSRRF-GSLEDIKNHPFFKEVDWNELR--ELKPPFVPEL  279 (333)
T ss_pred             HHHhhChhhhc-CCHHHHHhCcccCCCCHHHHh--hCCCCCCCCC
Confidence            34565555555 469999999999999999887  6889999975


No 71 
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=97.50  E-value=4.4e-05  Score=52.42  Aligned_cols=43  Identities=30%  Similarity=0.675  Sum_probs=36.6

Q ss_pred             CCccCCCCCccc----CChhhhhcCCCCCCCChhHHhcCcCCCCccC
Q psy10             2 PKHKAKTPIQQQ----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIP   44 (100)
Q Consensus         2 ~k~l~k~p~~r~----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P   44 (100)
                      ++.+..+|..|.    ..++++..||||..++|+.+..+..++||.|
T Consensus       244 ~~~l~~~p~~R~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  290 (290)
T cd05613         244 QRLLMKDPKKRLGCGPSDADEIKKHPFFQKINWDDLAAKKVPAPFKP  290 (290)
T ss_pred             HHHhcCCHHHhcCCCCCCHHHHHcCcccccCCHHHHhhccCCCCCCC
Confidence            456777788875    5789999999999999999999988888865


No 72 
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=97.46  E-value=9.2e-05  Score=52.23  Aligned_cols=31  Identities=32%  Similarity=0.774  Sum_probs=27.2

Q ss_pred             CChhhhhcCCCCCCCChhHHhcCcCCCCccCCC
Q psy10            14 LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPR   46 (100)
Q Consensus        14 ~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~   46 (100)
                      .+++++++|+||++++|+.+.  .+.+|++|..
T Consensus       258 ~~~~~~~~h~~f~~~~~~~~~--~~~~~~~p~~  288 (331)
T cd05624         258 NGIEDFKKHAFFEGIDWENIR--NLEAPYIPDV  288 (331)
T ss_pred             CCHHHHhcCCCcCCCCHHHHh--hCCCCccCCC
Confidence            478999999999999999884  5789999974


No 73 
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=97.45  E-value=0.00011  Score=50.45  Aligned_cols=42  Identities=48%  Similarity=0.892  Sum_probs=33.8

Q ss_pred             CccCCCCCccc----CChhhhhcCCCCCCCChhHHhcCcCCCCccC
Q psy10             3 KHKAKTPIQQQ----LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIP   44 (100)
Q Consensus         3 k~l~k~p~~r~----~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P   44 (100)
                      +.|.++|..|.    ..+.++.+||||++++|+.+..++.+|+-+|
T Consensus       232 ~~l~~~p~~R~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~  277 (278)
T cd05606         232 GLLQRDVNRRLGCLGRGAQEVKEHPFFRSLDWQMVFLQKYPPPLIP  277 (278)
T ss_pred             HHhhcCHHhccCCCCCCHHHHHhCccccCCCchHhhhcccCCCCCC
Confidence            44555666665    4789999999999999999999888877766


No 74 
>PF00433 Pkinase_C:  Protein kinase C terminal domain;  InterPro: IPR017892 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain is found in a large variety of protein kinases with different functions and dependencies. Protein kinase C, for example, is a calcium-activated, phospholipid-dependent serine- and threonine-specific enzyme. It is activated by diacylglycerol which, in turn, phosphorylates a range of cellular proteins. This domain is most often found associated with IPR000719 from INTERPRO.; GO: 0004674 protein serine/threonine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3E8D_A 1MRV_A 3E88_A 1GZO_A 1GZK_A 2JDO_A 2JDR_A 1MRY_A 1GZN_A 1O6L_A ....
Probab=97.39  E-value=8.3e-05  Score=38.82  Aligned_cols=36  Identities=19%  Similarity=0.271  Sum_probs=23.6

Q ss_pred             CCCCCCCCCCCccccCCCCC----------ChhhhcccCCcccCCC
Q psy10            51 AADAFDIGSFDEEDTKGIKL----------TEADQDLYKNFPLTIS   86 (100)
Q Consensus        51 ~~~~~d~~~f~~~~~~~~~~----------~~~~~~~F~~Fsy~~~   86 (100)
                      +++..|++||+++++.+.+.          ....+..|.||+|+++
T Consensus         2 v~~~~DtsnFD~eFt~~~~~~t~~~~~~~~~~~~~~~F~GFTy~~~   47 (48)
T PF00433_consen    2 VKSETDTSNFDPEFTEEPPVDTPPSDPSPLSSSMQENFQGFTYVNP   47 (48)
T ss_dssp             -SSTT-GTTSCHHHHTSSSSS--S--HHHHCTSSGGGGTT-CEETC
T ss_pred             CCchhhhhhcCcccccCCCCCCCcccCCcccccccCcCCCCeecCC
Confidence            46789999999988765421          2234567999999865


No 75 
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=97.17  E-value=0.00028  Score=48.90  Aligned_cols=44  Identities=32%  Similarity=0.597  Sum_probs=36.1

Q ss_pred             CCCccCCCCCcccC--ChhhhhcCCCCCCCChhHHhcCcCCCCccCCC
Q psy10             1 MPKHKAKTPIQQQL--RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPR   46 (100)
Q Consensus         1 l~k~l~k~p~~r~~--g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~   46 (100)
                      |++.+.++|..|..  ++.++.+||||.+++|..+...  ...++|.+
T Consensus       250 i~~~l~~~P~~R~~~~~~~~ll~~~~~~~~~~~~~~~~--~~~~~~~~  295 (305)
T cd05609         250 ISRLLRQNPLERLGTGGAFEVKQHRFFLGLDWNGLLRQ--KAEFIPQL  295 (305)
T ss_pred             HHHHhccChhhccCccCHHHHHhCccccCCCHHHHhhc--CCCCCCCC
Confidence            35678889999975  6899999999999999998754  45788875


No 76 
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=97.04  E-value=0.0003  Score=54.55  Aligned_cols=52  Identities=31%  Similarity=0.585  Sum_probs=41.1

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFD   61 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~   61 (100)
                      .++|.++|..|. .+.+|..|+||..++|+.+..  ..+||+|..     .+..|..+|+
T Consensus       615 ~~lL~~dP~~R~-ta~e~l~h~~~~~~~~~~~~~--~~~~~~~~~-----~~~~~~~~~~  666 (669)
T cd05610         615 EILLTMDPTKRA-GLKELKQHPLFHGVDWENLQN--QTMPFIPQP-----DDETDTSYFE  666 (669)
T ss_pred             HHHcccChhHCc-CHHHHHhCHhhcCCCHHHhcc--cCCCCCCCC-----CCcccccccc
Confidence            356888999996 789999999999999998876  558898863     4556666665


No 77 
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=96.99  E-value=0.00029  Score=48.98  Aligned_cols=43  Identities=37%  Similarity=0.740  Sum_probs=34.6

Q ss_pred             CCccCCCCCcccC---ChhhhhcCCCCCCCChhHHhcCcCCCCccCCC
Q psy10             2 PKHKAKTPIQQQL---RSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPR   46 (100)
Q Consensus         2 ~k~l~k~p~~r~~---g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~   46 (100)
                      ++.+.++|..|..   ++++|..||||++++|..+..  ..||-+|.+
T Consensus       266 ~~~l~~~p~~R~s~~~~~~~ll~~~~~~~~~~~~~~~--~~~~~~~~~  311 (316)
T cd05574         266 RKLLVKDPSKRLGSKRGAAEIKQHPFFRGVNWALIRH--TTPPIIPRP  311 (316)
T ss_pred             HHHccCCHhHCCCchhhHHHHHcCchhhcCChhhccc--CCCCCCCCc
Confidence            4567788888863   489999999999999998766  667777763


No 78 
>KOG0606|consensus
Probab=96.52  E-value=0.0019  Score=52.53  Aligned_cols=56  Identities=29%  Similarity=0.561  Sum_probs=42.8

Q ss_pred             CccCCCCCccc--CChhhhhcCCCCCCCChhHHhcCcCCCCccCCCCCCCCCCCCCCCCCCcccc
Q psy10             3 KHKAKTPIQQQ--LRSDEVKEHPFFTGLDWTQVYMQKYTPPLIPPRGEVNAADAFDIGSFDEEDT   65 (100)
Q Consensus         3 k~l~k~p~~r~--~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P~~~~~~~~~~~d~~~f~~~~~   65 (100)
                      ++|..++.+|+  .|..+++.|+||++++|+.|...+  .+|+|..     .+..|+++|.+.+.
T Consensus      1071 ~ll~~~~~qr~~a~~~~e~k~~~~~~~~~~~~l~~q~--~~~~p~~-----~s~~dtS~~~~r~~ 1128 (1205)
T KOG0606|consen 1071 RLLTEEPTQRLGAKGAAEVKGHPFFQDVDWENLALQK--AEFVPQP-----ESTQDTSYFESRFS 1128 (1205)
T ss_pred             hhhccCchhccCcccccccccCCccCCCCcccccccc--CccCCCC-----CCCCccchhhcccc
Confidence            45677788886  477799999999999999998755  6788875     34667777665443


No 79 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=95.82  E-value=0.0028  Score=43.87  Aligned_cols=29  Identities=17%  Similarity=0.206  Sum_probs=24.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWT   31 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~   31 (100)
                      ++.|..+|.+|+ .++++.+||||+++.+.
T Consensus       269 ~~mL~~dp~~R~-s~~~~l~h~~f~~~~~~  297 (303)
T cd07869         269 SKLLQCFPKNRL-SAQAALSHEYFSDLPPR  297 (303)
T ss_pred             HHHhccCchhcc-CHHHHhcCcccccCChh
Confidence            467888999997 68999999999998753


No 80 
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=94.48  E-value=0.013  Score=44.88  Aligned_cols=30  Identities=13%  Similarity=0.110  Sum_probs=25.9

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhH
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQ   32 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~   32 (100)
                      +++|.++|.+|+ .+.++.+||||.+.++..
T Consensus       431 ~~mL~~dP~kR~-ta~e~L~Hpff~~~~~~~  460 (566)
T PLN03225        431 KSMMRFKGRQRI-SAKAALAHPYFDREGLLG  460 (566)
T ss_pred             HHHccCCcccCC-CHHHHhCCcCcCCCCccc
Confidence            467889999997 689999999999988863


No 81 
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=94.16  E-value=0.015  Score=40.60  Aligned_cols=28  Identities=25%  Similarity=0.444  Sum_probs=23.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCCh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDW   30 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW   30 (100)
                      ++.|..+|..|. .+++|.+||||+++..
T Consensus       271 ~~~l~~~P~~Rp-t~~e~l~hp~f~~~~~  298 (338)
T cd07859         271 ERLLAFDPKDRP-TAEEALADPYFKGLAK  298 (338)
T ss_pred             HHHcCcCcccCC-CHHHHhcCchhhhcCc
Confidence            467888999996 6899999999987665


No 82 
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=93.93  E-value=0.019  Score=39.39  Aligned_cols=33  Identities=18%  Similarity=0.311  Sum_probs=27.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHhc
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYM   35 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~   35 (100)
                      ++.+..+|.+|. .+++|..||||..++|....+
T Consensus       250 ~~~l~~~p~~Rp-~~~~il~~~~~~~~~~~~~~~  282 (292)
T cd06644         250 KTALDKHPETRP-SAAQLLEHPFVSSVTSNRPLR  282 (292)
T ss_pred             HHHhcCCcccCc-CHHHHhcCccccccccchhHH
Confidence            466788999996 679999999999999987443


No 83 
>PHA03207 serine/threonine kinase US3; Provisional
Probab=93.92  E-value=0.016  Score=41.89  Aligned_cols=33  Identities=12%  Similarity=0.118  Sum_probs=28.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHhc
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYM   35 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~   35 (100)
                      ++.|..+|.+|. .+.||..||||....|+.|.-
T Consensus       356 ~~ml~~dp~~Rp-sa~e~l~~p~f~~~~~~~~~~  388 (392)
T PHA03207        356 AKMLTFDQEFRP-SAQDILSLPLFTKEPINLLNI  388 (392)
T ss_pred             HHHhccChhhCC-CHHHHhhCchhhccchhhhcC
Confidence            466788899986 789999999999999987753


No 84 
>PTZ00284 protein kinase; Provisional
Probab=93.65  E-value=0.023  Score=42.10  Aligned_cols=26  Identities=8%  Similarity=0.141  Sum_probs=22.3

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      |+++|..||.+|+ .++||..||||..
T Consensus       418 i~~mL~~dP~~R~-ta~e~L~Hp~~~~  443 (467)
T PTZ00284        418 IYGLLHYDRQKRL-NARQMTTHPYVLK  443 (467)
T ss_pred             HHHhCCcChhhCC-CHHHHhcCccccc
Confidence            3567899999997 7899999999974


No 85 
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=93.49  E-value=0.036  Score=39.49  Aligned_cols=25  Identities=20%  Similarity=0.369  Sum_probs=21.4

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      |.+.|..+|..|+ .+.++..||||.
T Consensus       298 l~~mL~~dP~~R~-t~~e~L~hp~~~  322 (364)
T cd07875         298 LSKMLVIDASKRI-SVDEALQHPYIN  322 (364)
T ss_pred             HHHhcCcCcccCC-CHHHHhcCcccc
Confidence            3467888999997 789999999996


No 86 
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=93.44  E-value=0.026  Score=38.91  Aligned_cols=28  Identities=21%  Similarity=0.364  Sum_probs=23.1

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      |++.|..+|.+|. .+++|+.||||+.+-
T Consensus       266 i~~ml~~dp~~R~-t~~eil~h~~f~~~~  293 (301)
T cd07873         266 LSKLLQFEGRKRI-SAEEAMKHPYFHCLG  293 (301)
T ss_pred             HHHHhcCCcccCc-CHHHHhcCccccccc
Confidence            3567888999997 689999999997654


No 87 
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=93.35  E-value=0.023  Score=39.36  Aligned_cols=27  Identities=19%  Similarity=0.379  Sum_probs=22.6

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      |++.|..+|.+|. .+.|++.||||+++
T Consensus       266 i~~~L~~dp~~R~-t~~e~l~h~~~~~~  292 (309)
T cd07872         266 LTKFLQYESKKRI-SAEEAMKHAYFRSL  292 (309)
T ss_pred             HHHhccCChhhCC-CHHHHhcChhhhhc
Confidence            3567888999997 68999999999754


No 88 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=93.22  E-value=0.017  Score=42.68  Aligned_cols=29  Identities=21%  Similarity=0.352  Sum_probs=24.3

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCCh
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLDW   30 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~idW   30 (100)
                      |++.|.++|.+|+ ++.++..||||.++..
T Consensus       331 i~~~L~~dP~~R~-ta~e~l~hp~f~~~~~  359 (440)
T PTZ00036        331 ISQFLKYEPLKRL-NPIEALADPFFDDLRD  359 (440)
T ss_pred             HHHHCCCChhHCc-CHHHHhCChhHHhhhc
Confidence            3567899999997 7899999999987654


No 89 
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=92.87  E-value=0.025  Score=38.55  Aligned_cols=32  Identities=22%  Similarity=0.273  Sum_probs=26.1

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVY   34 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~   34 (100)
                      ++.+.++|..|. .+++|..||||+...|....
T Consensus       248 ~~~l~~~p~~Rp-t~~~i~~~~~~~~~~~~~~~  279 (288)
T cd06616         248 NLCLIKDESKRP-KYKELLEHPFIKDYEERNVD  279 (288)
T ss_pred             HHHccCChhhCc-CHHHHhcChhhhchhhcchh
Confidence            456788899986 68999999999988876544


No 90 
>PHA03210 serine/threonine kinase US3; Provisional
Probab=92.22  E-value=0.049  Score=40.96  Aligned_cols=34  Identities=12%  Similarity=0.077  Sum_probs=28.3

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhHHhcC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQ   36 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k   36 (100)
                      .+.|..+|.+|. ++.|+..||||.+.+.+.+...
T Consensus       435 ~kmL~~DP~~Rp-sa~elL~hp~f~~~~~~~~~~~  468 (501)
T PHA03210        435 VKMLTFDWHLRP-GAAELLALPLFSAEEEEEILFI  468 (501)
T ss_pred             HHHhccCcccCc-CHHHHhhChhhhcCCchHHHHH
Confidence            467889999995 7899999999999888776554


No 91 
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=92.03  E-value=0.049  Score=38.96  Aligned_cols=28  Identities=11%  Similarity=0.165  Sum_probs=24.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCCh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDW   30 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW   30 (100)
                      ++.|..+|.+|. ++.++..||||++..+
T Consensus       269 ~~mL~~dP~~R~-t~~e~l~hp~~~~~~~  296 (372)
T cd07853         269 CRMLVFDPDKRI-SAADALAHPYLDEGRL  296 (372)
T ss_pred             HHhCCCChhhCc-CHHHHhcCHhhCCCcc
Confidence            467889999997 7899999999998654


No 92 
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=91.73  E-value=0.055  Score=38.43  Aligned_cols=25  Identities=28%  Similarity=0.368  Sum_probs=21.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      .+.|..+|..|+ ++.||..||||..
T Consensus       296 ~~mL~~dP~~R~-t~~e~l~hp~~~~  320 (359)
T cd07876         296 SKMLVIDPDKRI-SVDEALRHPYITV  320 (359)
T ss_pred             HHHhccCcccCC-CHHHHhcCchhhh
Confidence            467888999997 7899999999974


No 93 
>PHA03212 serine/threonine kinase US3; Provisional
Probab=91.65  E-value=0.047  Score=39.74  Aligned_cols=26  Identities=12%  Similarity=0.129  Sum_probs=22.0

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      |++.|..+|.+|. .++|+..||||+.
T Consensus       356 i~~mL~~dP~~Rp-ta~elL~hp~f~~  381 (391)
T PHA03212        356 ICKMLAFDAHHRP-SAEALLDFAAFQD  381 (391)
T ss_pred             HHHHhcCChhhCC-CHHHHhcChhhcc
Confidence            3567889999996 7899999999975


No 94 
>KOG0585|consensus
Probab=91.24  E-value=0.041  Score=41.76  Aligned_cols=25  Identities=28%  Similarity=0.454  Sum_probs=21.7

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      |.|+|+|||++|. .+.+||.|||-.
T Consensus       352 i~~lL~KdP~~Ri-~l~~ik~Hpwvt  376 (576)
T KOG0585|consen  352 IKRLLEKDPEQRI-TLPDIKLHPWVT  376 (576)
T ss_pred             HHHHhhcChhhee-ehhhheecceec
Confidence            4578999999997 689999999964


No 95 
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=91.20  E-value=0.059  Score=37.30  Aligned_cols=25  Identities=16%  Similarity=0.238  Sum_probs=20.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.|..+|..|. .+++|..||||++
T Consensus       271 ~~ml~~dp~~R~-t~~~il~h~~f~~  295 (309)
T cd07845         271 NFLLMYDPKKRA-TAEEALESSYFKE  295 (309)
T ss_pred             HHHhcCChhhCc-CHHHHhcChhhcc
Confidence            456778899996 6899999999973


No 96 
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=91.17  E-value=0.058  Score=38.13  Aligned_cols=29  Identities=21%  Similarity=0.258  Sum_probs=24.1

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWT   31 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~   31 (100)
                      ++.|..+|.+|. ++++|..||||.++...
T Consensus       278 ~~~l~~dP~~R~-~~~e~l~h~~f~~~~~~  306 (342)
T cd07879         278 EKMLELDVDKRL-TATEALEHPYFDSFRDA  306 (342)
T ss_pred             HHHcCCChhhCc-CHHHHhcCcchhhcccc
Confidence            456888999997 68999999999988653


No 97 
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=90.83  E-value=0.081  Score=37.24  Aligned_cols=26  Identities=19%  Similarity=0.312  Sum_probs=21.9

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.|..+|.+|. .+.+|.+||||...
T Consensus       279 ~~mL~~dp~~R~-s~~ell~hp~~~~~  304 (343)
T cd07878         279 EKMLVLDSDKRI-SASEALAHPYFSQY  304 (343)
T ss_pred             HHHcCCChhhCC-CHHHHhcCcchhcc
Confidence            467888999997 68999999999754


No 98 
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=90.62  E-value=0.055  Score=38.06  Aligned_cols=27  Identities=19%  Similarity=0.283  Sum_probs=22.5

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      .+.|.++|..|. .+.+|..||||+...
T Consensus       282 ~~~L~~~P~~Rp-t~~ell~h~~~~~~~  308 (331)
T cd06649         282 NKCLIKNPAERA-DLKMLMNHTFIKRSE  308 (331)
T ss_pred             HHHccCCcccCC-CHHHHhcChHHhhcc
Confidence            467889999996 789999999997543


No 99 
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=90.58  E-value=0.06  Score=37.92  Aligned_cols=26  Identities=23%  Similarity=0.409  Sum_probs=22.1

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.|..+|..|. ++++|..||||+.+
T Consensus       272 ~~~l~~~P~~Rp-s~~ell~h~~~~~~  297 (337)
T cd07858         272 EKMLVFDPSKRI-TVEEALAHPYLASL  297 (337)
T ss_pred             HHHhcCChhhcc-CHHHHHcCcchhhh
Confidence            467888999997 68999999999864


No 100
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=90.31  E-value=0.11  Score=36.65  Aligned_cols=25  Identities=20%  Similarity=0.333  Sum_probs=21.2

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.|.++|..|. .+.+|..||||..
T Consensus       279 ~~~l~~~P~~Rp-t~~ell~h~~~~~  303 (343)
T cd07851         279 EKMLVLDPDKRI-TAAEALAHPYLAE  303 (343)
T ss_pred             HHhCCCChhhCC-CHHHHhcCCCccc
Confidence            456888999996 6899999999984


No 101
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=90.08  E-value=0.076  Score=36.71  Aligned_cols=26  Identities=15%  Similarity=0.317  Sum_probs=21.5

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.|..+|..|. .+++|.+||||+.+
T Consensus       276 ~~~l~~~P~~Rp-t~~~ll~~p~~~~~  301 (314)
T cd08216         276 ELCLQRDPESRP-SASQLLNHSFFKQC  301 (314)
T ss_pred             HHHhhcCCCcCc-CHHHHhcCchHhhh
Confidence            456788999996 68999999999855


No 102
>KOG0615|consensus
Probab=89.74  E-value=0.11  Score=38.90  Aligned_cols=28  Identities=21%  Similarity=0.324  Sum_probs=23.4

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCCh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDW   30 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW   30 (100)
                      .++|.-+|..|. .+.|.++||||+.+.-
T Consensus       418 ~~mL~VdP~~R~-s~~eaL~hpW~~~~~~  445 (475)
T KOG0615|consen  418 NWMLVVDPENRP-SADEALNHPWFKDAPC  445 (475)
T ss_pred             HHhhEeCcccCc-CHHHHhcChhhhcccc
Confidence            457888999996 6789999999997763


No 103
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=89.54  E-value=0.073  Score=37.29  Aligned_cols=27  Identities=15%  Similarity=0.374  Sum_probs=22.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      ++.|..+|.+|. .+++|..||||+.+.
T Consensus       288 ~~~l~~dP~~Rp-t~~ell~~p~f~~~~  314 (327)
T cd08227         288 EQCLQRNPDARP-SASTLLNHSFFKQIK  314 (327)
T ss_pred             HHHHhhCchhcC-CHHHHhcChhhhhcc
Confidence            456778899986 679999999998764


No 104
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=89.50  E-value=0.08  Score=35.86  Aligned_cols=29  Identities=24%  Similarity=0.194  Sum_probs=24.1

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWT   31 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~   31 (100)
                      ++.+.++|..|. .+.+|..|+||......
T Consensus       242 ~~~l~~~p~~Rp-~~~~il~~~~~~~~~~~  270 (283)
T cd06617         242 NKCLKKNYKERP-NYPELLQHPFFELHLSK  270 (283)
T ss_pred             HHHccCChhhCc-CHHHHhcCchhhhcccc
Confidence            467888999996 67999999999987655


No 105
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=89.12  E-value=0.13  Score=36.22  Aligned_cols=26  Identities=19%  Similarity=0.336  Sum_probs=21.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.|..+|..|. ++.+|..||||+.+
T Consensus       273 ~~~l~~dP~~Rp-t~~e~l~hp~~~~~  298 (336)
T cd07849         273 DKMLTFNPHKRI-TVEEALAHPYLEQY  298 (336)
T ss_pred             HHHcCCChhhCc-CHHHHhcCcccccc
Confidence            467888999997 68999999999844


No 106
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=89.11  E-value=0.15  Score=36.06  Aligned_cols=26  Identities=15%  Similarity=0.365  Sum_probs=21.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.|..+|..|. .+++|..||||+.+
T Consensus       281 ~~~L~~dP~~R~-t~~ell~h~~~~~~  306 (342)
T cd07854         281 EQILTFNPMDRL-TAEEALMHPYMSCY  306 (342)
T ss_pred             HHHhCCCchhcc-CHHHHhCCCccccc
Confidence            467888999997 68999999999854


No 107
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=89.04  E-value=0.12  Score=35.34  Aligned_cols=25  Identities=20%  Similarity=0.466  Sum_probs=21.3

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.+.++|..|. .+.+|..|+||++
T Consensus       263 ~~~l~~~P~~R~-s~~e~l~~~~~~~  287 (298)
T cd07841         263 QRLLTLNPNKRI-TARQALEHPYFSN  287 (298)
T ss_pred             HHHhcCCcccCc-CHHHHhhCccccC
Confidence            456788999997 7899999999985


No 108
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=88.92  E-value=0.092  Score=37.06  Aligned_cols=27  Identities=19%  Similarity=0.283  Sum_probs=22.5

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      |.+.|.++|..|. .+.||+.|+||+..
T Consensus       279 i~~~L~~~P~~Rp-t~~ell~h~~~~~~  305 (333)
T cd06650         279 VNKCLIKNPAERA-DLKQLMVHAFIKRS  305 (333)
T ss_pred             HHHhccCCcccCc-CHHHHhhCHHHhcC
Confidence            3578899999996 68999999999753


No 109
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=88.90  E-value=0.092  Score=36.62  Aligned_cols=26  Identities=27%  Similarity=0.439  Sum_probs=21.7

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.|.++|..|. .+++|..||||+++
T Consensus       270 ~~~l~~~P~~Rp-t~~~ll~~~~~~~~  295 (330)
T cd07834         270 EKMLVFDPKKRI-TADEALAHPYLAQL  295 (330)
T ss_pred             HHHccCChhhCC-CHHHHHhCccHHhh
Confidence            457888999997 68999999999853


No 110
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=88.44  E-value=0.16  Score=35.55  Aligned_cols=26  Identities=15%  Similarity=0.308  Sum_probs=21.7

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.|.++|..|+ .+++|..|+||++.
T Consensus       294 ~~~l~~~P~~R~-s~~~~l~~~~~~~~  319 (335)
T PTZ00024        294 QSLLKLNPLERI-SAKEALKHEYFKSD  319 (335)
T ss_pred             HHHcCCCchhcc-CHHHHhcCcccCCC
Confidence            456888999997 68999999999844


No 111
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=88.27  E-value=0.06  Score=37.72  Aligned_cols=26  Identities=15%  Similarity=0.328  Sum_probs=21.5

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      |++.|..+|..|. .+.+|.+|+||+.
T Consensus       288 i~~~l~~dP~~Rp-ta~e~l~~~~~~~  313 (328)
T cd08226         288 VELCLQQDPEKRP-SASSLLSHAFFKQ  313 (328)
T ss_pred             HHHHccCCcccCC-CHHHHhhCHHHHH
Confidence            3567888999995 6899999999963


No 112
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=88.18  E-value=0.16  Score=36.06  Aligned_cols=26  Identities=15%  Similarity=0.294  Sum_probs=22.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.|.++|..|. .+.||..||||.+-
T Consensus       309 ~~~l~~~P~~Rp-t~~ell~hp~~~~~  334 (353)
T PLN00034        309 SCCLQREPAKRW-SAMQLLQHPFILRA  334 (353)
T ss_pred             HHHccCChhhCc-CHHHHhcCcccccC
Confidence            467888999996 68999999999863


No 113
>KOG0665|consensus
Probab=88.01  E-value=0.18  Score=36.63  Aligned_cols=39  Identities=18%  Similarity=0.341  Sum_probs=30.7

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCCccC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPPLIP   44 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP~~P   44 (100)
                      |.+.|..+|..|. +++++..|||++  -|  ....++++|..+
T Consensus       290 l~~MLvi~pe~Ri-sv~daL~HPY~~--vw--~~~~ev~ap~pe  328 (369)
T KOG0665|consen  290 LSKMLVIDPEKRI-SVDDALRHPYIK--VW--YDPDEVEAPPPE  328 (369)
T ss_pred             HHHhhccChhhcc-cHHHHhcCCeee--ee--cccccccCCCCc
Confidence            3567888999996 789999999999  67  455667776666


No 114
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=87.62  E-value=0.15  Score=36.13  Aligned_cols=26  Identities=19%  Similarity=0.305  Sum_probs=21.4

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      .+.|.++|.+|. .+.++..||||+.+
T Consensus       279 ~~~l~~dP~~R~-t~~~~l~~~~~~~~  304 (343)
T cd07880         279 EKMLVLDAESRI-TAAEALAHPYFEEF  304 (343)
T ss_pred             HHHcCCChhhCC-CHHHHhcCccHhhh
Confidence            356788999997 57899999999855


No 115
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=87.58  E-value=0.17  Score=35.78  Aligned_cols=25  Identities=24%  Similarity=0.398  Sum_probs=21.1

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.|..+|.+|+ .+.+|..||||..
T Consensus       292 ~~mL~~dP~~Rp-s~~ell~hp~~~~  316 (355)
T cd07874         292 SKMLVIDPAKRI-SVDEALQHPYINV  316 (355)
T ss_pred             HHHhcCCchhcC-CHHHHhcCcchhc
Confidence            456888999997 7899999999973


No 116
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=87.46  E-value=0.18  Score=35.46  Aligned_cols=24  Identities=21%  Similarity=0.368  Sum_probs=20.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      ++.+..+|.+|. .+++|..|+||.
T Consensus       269 ~~~l~~~P~~R~-t~~ell~~~~~~  292 (328)
T cd07856         269 EKMLVFDPQKRI-SAAEALAHPYLA  292 (328)
T ss_pred             HHHcCCChhhCC-CHHHHhcCCccc
Confidence            456788899997 578999999995


No 117
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=87.26  E-value=0.22  Score=34.09  Aligned_cols=27  Identities=19%  Similarity=0.316  Sum_probs=21.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      ++.+.++|..|. .+.||..|+||+...
T Consensus       247 ~~~l~~~p~~Rp-t~~eil~~~~~~~~~  273 (287)
T cd06621         247 KQCLEKDPTRRP-TPWDMLEHPWIKAQM  273 (287)
T ss_pred             HHHcCCCcccCC-CHHHHHhCccccccc
Confidence            456788999996 689999999996543


No 118
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=87.03  E-value=0.2  Score=33.95  Aligned_cols=29  Identities=21%  Similarity=0.312  Sum_probs=23.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWT   31 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~   31 (100)
                      ++.+..+|..|. .+++|.+|+||......
T Consensus       243 ~~~l~~~p~~Rp-s~~~il~~~~~~~~~~~  271 (280)
T cd06611         243 KSCLVKDPDDRP-TAAELLKHPFVSDQSDN  271 (280)
T ss_pred             HHHhccChhhCc-CHHHHhcChhhcccchh
Confidence            456788899996 68999999999987544


No 119
>KOG0575|consensus
Probab=86.44  E-value=0.21  Score=38.61  Aligned_cols=24  Identities=38%  Similarity=0.646  Sum_probs=21.2

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFF   25 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF   25 (100)
                      |+++|.++|..|+ .+++|..|+||
T Consensus       249 I~~lL~~~P~~Rp-sl~~vL~h~Ff  272 (592)
T KOG0575|consen  249 IRKLLRPNPSERP-SLDEVLDHPFF  272 (592)
T ss_pred             HHHHhcCCcccCC-CHHHHhcCHhh
Confidence            4578999999996 78999999999


No 120
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=86.16  E-value=0.22  Score=33.66  Aligned_cols=27  Identities=19%  Similarity=0.297  Sum_probs=22.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      ++.+..+|..|. ++++|..|+||.+..
T Consensus       232 ~~~l~~~p~~Rp-t~~~il~~~~~~~~~  258 (274)
T cd06609         232 SLCLNKDPKERP-SAKELLKHKFIKKAK  258 (274)
T ss_pred             HHHhhCChhhCc-CHHHHhhChhhcCCC
Confidence            456788999996 789999999998543


No 121
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=85.62  E-value=0.27  Score=33.48  Aligned_cols=27  Identities=19%  Similarity=0.486  Sum_probs=21.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      .+.+.++|..|+ .+++|..||||...+
T Consensus       234 ~~~l~~~P~~Rp-~~~eil~~~~~~~~~  260 (279)
T cd06619         234 TQCMRKQPKERP-APENLMDHPFIVQYN  260 (279)
T ss_pred             HHHhhCChhhCC-CHHHHhcCccccccc
Confidence            356778888887 589999999998654


No 122
>KOG0583|consensus
Probab=85.48  E-value=0.25  Score=36.13  Aligned_cols=26  Identities=27%  Similarity=0.340  Sum_probs=22.2

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      .+.|..+|..|. .+.+|+.||||+.-
T Consensus       256 ~~mL~~~P~~R~-t~~~i~~h~w~~~~  281 (370)
T KOG0583|consen  256 EKMLVPDPSTRI-TLLEILEHPWFQKE  281 (370)
T ss_pred             HHHcCCCcccCC-CHHHHhhChhhccC
Confidence            567888999986 78999999999964


No 123
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=85.25  E-value=0.24  Score=35.06  Aligned_cols=25  Identities=20%  Similarity=0.442  Sum_probs=21.5

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      |++.|..+|..|+ .+.+|..||||+
T Consensus       291 i~~~L~~dP~~R~-t~~eiL~~~~~~  315 (353)
T cd07850         291 LSKMLVIDPEKRI-SVDDALQHPYIN  315 (353)
T ss_pred             HHHHcCCChhhCc-CHHHHhcChhHh
Confidence            3567888999997 789999999998


No 124
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=85.05  E-value=0.24  Score=34.75  Aligned_cols=24  Identities=17%  Similarity=0.380  Sum_probs=20.7

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      ++.|..+|.+|. ++.+|..||||.
T Consensus       275 ~~~l~~~P~~Rp-t~~~~l~~~~~~  298 (334)
T cd07855         275 SQMLQFDPEERI-TVEQALQHPFLA  298 (334)
T ss_pred             HHHccCChhhCc-CHHHHHhChhhh
Confidence            456788899997 689999999997


No 125
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=84.53  E-value=0.28  Score=34.00  Aligned_cols=25  Identities=28%  Similarity=0.486  Sum_probs=21.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      .+.+..+|..|. .+.+|..||||.+
T Consensus       268 ~~~l~~~P~~Rp-t~~~ll~~~~~~~  292 (308)
T cd06615         268 DKCLKKNPKERA-DLKELTKHPFIKR  292 (308)
T ss_pred             HHHccCChhhCc-CHHHHhcChhhhh
Confidence            456788999996 6899999999975


No 126
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=83.25  E-value=0.34  Score=34.28  Aligned_cols=25  Identities=12%  Similarity=0.179  Sum_probs=20.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.|.++|..|. .+.++..||||+.
T Consensus       281 ~~~L~~dp~~R~-t~~e~l~h~~f~~  305 (345)
T cd07877         281 EKMLVLDSDKRI-TAAQALAHAYFAQ  305 (345)
T ss_pred             HHHcCCChhhcC-CHHHHhcChhhhh
Confidence            356788899996 6789999999983


No 127
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=83.08  E-value=0.3  Score=33.64  Aligned_cols=25  Identities=24%  Similarity=0.420  Sum_probs=20.7

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.+.++|..|. .+++|..|+||+.
T Consensus       253 ~~~l~~~P~~Rp-t~~~il~~~~~~~  277 (292)
T cd06658         253 DLMLVREPSQRA-TAQELLQHPFLKL  277 (292)
T ss_pred             HHHccCChhHCc-CHHHHhhChhhhc
Confidence            456778999996 6899999999973


No 128
>KOG0581|consensus
Probab=82.43  E-value=0.31  Score=35.66  Aligned_cols=24  Identities=21%  Similarity=0.422  Sum_probs=20.3

Q ss_pred             CccCCCCCcccCChhhhhcCCCCCC
Q psy10             3 KHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         3 k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      +.|.|+|..|. ++.++.+|||+++
T Consensus       317 ~CL~Kdp~~R~-s~~qLl~Hpfi~~  340 (364)
T KOG0581|consen  317 CCLRKDPSERP-SAKQLLQHPFIKK  340 (364)
T ss_pred             HHhcCCcccCC-CHHHHhcCHHHhh
Confidence            46788899985 7899999999974


No 129
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=81.98  E-value=0.42  Score=32.44  Aligned_cols=25  Identities=24%  Similarity=0.271  Sum_probs=20.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.+.++|..|. .+++|..||||+.
T Consensus       243 ~~~l~~~p~~Rp-~~~~il~~~~~~~  267 (282)
T cd06643         243 KKCLEKNVDARW-TTTQLLQHPFVTV  267 (282)
T ss_pred             HHHccCChhhCc-CHHHHhcCCCEec
Confidence            467788899996 5799999999974


No 130
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=81.98  E-value=0.42  Score=32.47  Aligned_cols=26  Identities=23%  Similarity=0.395  Sum_probs=20.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.+.++|..|. .+.+|..||||...
T Consensus       243 ~~~l~~~p~~Rp-~~~~l~~~~~~~~~  268 (286)
T cd06622         243 AKCLNKIPNRRP-TYAQLLEHPWLVKY  268 (286)
T ss_pred             HHHcccCcccCC-CHHHHhcChhhhhc
Confidence            456788899986 68999999999643


No 131
>KOG0588|consensus
Probab=81.87  E-value=0.66  Score=36.79  Aligned_cols=39  Identities=21%  Similarity=0.467  Sum_probs=28.3

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCChhHHhcCcCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQVYMQKYTPP   41 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~l~~k~~~pP   41 (100)
                      |+|.|..||+.|+ ..+||..|||..+..=... .+.+.+|
T Consensus       243 Lr~ml~VDp~~Ri-T~~eI~kHP~l~g~~~~~~-~~~~~~~  281 (786)
T KOG0588|consen  243 LRRMLDVDPSTRI-TTEEILKHPFLSGYTSLPS-SKSLRPP  281 (786)
T ss_pred             HHHHhccCccccc-cHHHHhhCchhhcCCCCCh-hhhcCCC
Confidence            4677889999997 5799999999987764332 2334444


No 132
>KOG0604|consensus
Probab=81.63  E-value=0.39  Score=34.90  Aligned_cols=26  Identities=23%  Similarity=0.459  Sum_probs=22.0

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++++|.-+|..|+ .++++++|||..+
T Consensus       302 IR~LLkt~PteRl-TI~~~m~hpwi~~  327 (400)
T KOG0604|consen  302 IRKLLKTEPTERL-TIEEVMDHPWINQ  327 (400)
T ss_pred             HHHHhcCCchhhe-eHHHhhcCchhcc
Confidence            4678889999998 6899999999864


No 133
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=81.02  E-value=0.45  Score=32.12  Aligned_cols=27  Identities=7%  Similarity=0.193  Sum_probs=21.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      ++.+..+|..|. .+.+|..|+||+...
T Consensus       236 ~~~l~~~p~~R~-~~~~il~~~~~~~~~  262 (277)
T cd06917         236 AACLDEEPKERL-SAEELLKSKWIKAHS  262 (277)
T ss_pred             HHHcCCCcccCc-CHHHHhhChHhhccc
Confidence            456788999997 689999999997543


No 134
>KOG0579|consensus
Probab=80.73  E-value=0.56  Score=37.49  Aligned_cols=31  Identities=16%  Similarity=0.355  Sum_probs=25.8

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCChhH
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQ   32 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~   32 (100)
                      |.+.|.|+|..|. .+.++..||||.+++-.+
T Consensus       269 Lk~cL~Knp~~Rp-~aaqll~Hpfv~~~~SnK  299 (1187)
T KOG0579|consen  269 LKRCLVKNPRNRP-PAAQLLKHPFVQNAPSNK  299 (1187)
T ss_pred             HHHHHhcCCccCC-CHHHHhhCcccccCCcch
Confidence            4578999999996 568999999999887654


No 135
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=79.80  E-value=0.51  Score=33.10  Aligned_cols=26  Identities=23%  Similarity=0.402  Sum_probs=21.1

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      .+.+..+|..|. .+.+|..|+||+++
T Consensus       276 ~~~l~~~P~~Rp-s~~~il~~~~~~~~  301 (337)
T cd07852         276 KKLLVFNPNKRL-TAEEALEHPYVAQF  301 (337)
T ss_pred             HHhccCCccccc-CHHHHhhChhhhhh
Confidence            356778899996 57899999999875


No 136
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=79.36  E-value=0.63  Score=32.10  Aligned_cols=24  Identities=17%  Similarity=0.314  Sum_probs=20.2

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      .+.+.++|..|. .+.+|..||||+
T Consensus       250 ~~~l~~~p~~Rp-s~~~il~~~~~~  273 (297)
T cd06656         250 NRCLEMDVDRRG-SAKELLQHPFLK  273 (297)
T ss_pred             HHHccCChhhCc-CHHHHhcCchhc
Confidence            467788899885 689999999997


No 137
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=79.18  E-value=0.67  Score=31.72  Aligned_cols=26  Identities=23%  Similarity=0.487  Sum_probs=21.3

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.+..+|..|. .+.+|..|+||+..
T Consensus       250 ~~~l~~~p~~Rp-t~~~il~~~~~~~~  275 (285)
T cd06648         250 DRMLVRDPAQRA-TAAELLNHPFLAKA  275 (285)
T ss_pred             HHHcccChhhCc-CHHHHccCcccccC
Confidence            466788999996 67999999999753


No 138
>KOG1167|consensus
Probab=78.85  E-value=0.65  Score=34.60  Aligned_cols=28  Identities=25%  Similarity=0.512  Sum_probs=23.5

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      |.|+|+.+|.+|. +++|-..||||...+
T Consensus       361 Ldk~le~np~kRi-tAEeALkHpFF~~~~  388 (418)
T KOG1167|consen  361 LDKCLELNPQKRI-TAEDALKHPFFDEAD  388 (418)
T ss_pred             HHHHccCChhhcc-cHHHHhcCcCCcchh
Confidence            4578999999996 789999999998444


No 139
>KOG0593|consensus
Probab=77.65  E-value=0.43  Score=34.69  Aligned_cols=26  Identities=23%  Similarity=0.533  Sum_probs=21.7

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      |+++|.++|..|. ..+++..|+||.+
T Consensus       264 ~k~cL~~dP~~R~-sc~qll~H~yFd~  289 (396)
T KOG0593|consen  264 LKKCLKMDPDDRL-SCEQLLHHPYFDG  289 (396)
T ss_pred             HHHHhcCCccccc-cHHHHhcChHHHH
Confidence            4578899999997 5799999999943


No 140
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=77.53  E-value=0.57  Score=32.32  Aligned_cols=24  Identities=25%  Similarity=0.555  Sum_probs=19.5

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      ++.+.++|.+|. .+.+|..|+||.
T Consensus       251 ~~~l~~~P~~R~-~~~~ll~~~~~~  274 (292)
T cd06657         251 DRLLVRDPAQRA-TAAELLKHPFLA  274 (292)
T ss_pred             HHHHhCCcccCc-CHHHHhcChHHh
Confidence            356778888886 678999999996


No 141
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=77.48  E-value=0.86  Score=31.70  Aligned_cols=27  Identities=22%  Similarity=0.209  Sum_probs=22.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      ++.+.++|..|. .+.+|..||||+...
T Consensus       254 ~~~l~~~P~~Rp-~~~~~l~~~~~~~~~  280 (313)
T cd06633         254 DYCLQKIPQERP-ASAELLRHDFVRRDR  280 (313)
T ss_pred             HHHccCChhhCc-CHHHHhcCcccCCCc
Confidence            456788899886 589999999998655


No 142
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=77.45  E-value=0.67  Score=31.79  Aligned_cols=24  Identities=21%  Similarity=0.332  Sum_probs=20.4

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      ++.+.++|..|+ .+++|..|+||.
T Consensus       254 ~~~l~~~p~~Rp-~~~~il~~~~~~  277 (296)
T cd06618         254 DLCLTKDHRKRP-KYRELLQHPFIR  277 (296)
T ss_pred             HHHccCChhhCC-CHHHHhcChhhh
Confidence            466788999997 589999999997


No 143
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=76.85  E-value=0.59  Score=31.80  Aligned_cols=30  Identities=23%  Similarity=0.362  Sum_probs=24.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhH
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQ   32 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~   32 (100)
                      ++.++.+|..|. .+.+|..|+||+...|..
T Consensus       251 ~~~l~~~p~~Rp-t~~~il~~~~~~~~~~~~  280 (286)
T cd06614         251 NKCLVKDPEKRP-SAEELLQHPFLKKACPKE  280 (286)
T ss_pred             HHHhccChhhCc-CHHHHhhChHhhccCchH
Confidence            456778889985 679999999999866653


No 144
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=75.96  E-value=0.63  Score=32.02  Aligned_cols=27  Identities=15%  Similarity=0.229  Sum_probs=21.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      ++.+..+|..|. .+.+|..|+||+...
T Consensus       250 ~~~l~~~p~~Rp-~~~~il~h~~~~~~~  276 (293)
T cd06647         250 NRCLEMDVEKRG-SAKELLQHPFLKIAK  276 (293)
T ss_pred             HHHccCChhhCc-CHHHHhcCHHHhcCc
Confidence            456788999995 789999999997443


No 145
>KOG0582|consensus
Probab=75.22  E-value=1.1  Score=34.06  Aligned_cols=26  Identities=19%  Similarity=0.351  Sum_probs=20.0

Q ss_pred             ccCCCCCcccCChhhhhcCCCCCCCCh
Q psy10             4 HKAKTPIQQQLRSDEVKEHPFFTGLDW   30 (100)
Q Consensus         4 ~l~k~p~~r~~g~~eIk~HpfF~~idW   30 (100)
                      +|.|+|.+|. .++++..|+||+..-=
T Consensus       276 CL~kDP~kRp-tAskLlkh~FFk~~k~  301 (516)
T KOG0582|consen  276 CLVKDPSKRP-TASKLLKHAFFKKAKS  301 (516)
T ss_pred             HhhcCcccCC-CHHHHhccHHHhhccc
Confidence            4667777774 6799999999986543


No 146
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=75.19  E-value=0.93  Score=31.75  Aligned_cols=24  Identities=29%  Similarity=0.472  Sum_probs=20.1

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      .+.+..+|..|. .+.++..|||++
T Consensus       273 ~~~l~~~P~~R~-t~~~ll~~~~~~  296 (332)
T cd07857         273 EKLLAFDPTKRI-SVEEALEHPYLA  296 (332)
T ss_pred             HHHccCCcccCC-CHHHHhcChhhh
Confidence            466888999997 688999999984


No 147
>KOG0603|consensus
Probab=74.77  E-value=0.93  Score=35.39  Aligned_cols=24  Identities=25%  Similarity=0.527  Sum_probs=20.8

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFF   25 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF   25 (100)
                      |+.+|..+|..|+ ++.+|..|+||
T Consensus       543 l~~LL~~dP~~Rl-~~~~i~~h~w~  566 (612)
T KOG0603|consen  543 LQQLLQVDPALRL-GADEIGAHPWF  566 (612)
T ss_pred             HHHhccCChhhCc-ChhhhccCcch
Confidence            4567888999997 78999999999


No 148
>KOG0032|consensus
Probab=74.61  E-value=1.4  Score=32.45  Aligned_cols=26  Identities=15%  Similarity=0.323  Sum_probs=21.4

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      +++|.++|..|+ .+.++..|||.++.
T Consensus       274 ~~ll~~dp~~R~-ta~~~L~HpWi~~~  299 (382)
T KOG0032|consen  274 RKLLEFDPRKRL-TAAQALQHPWIKSI  299 (382)
T ss_pred             HHhcccCcccCC-CHHHHhcCccccCC
Confidence            578899999987 67899999996644


No 149
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=74.60  E-value=0.92  Score=31.24  Aligned_cols=25  Identities=12%  Similarity=0.149  Sum_probs=20.9

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.+.++|..|. .+.+|..|+||..
T Consensus       251 ~~~l~~~p~~Rp-t~~eil~~~~~~~  275 (296)
T cd06654         251 NRCLDMDVEKRG-SAKELLQHQFLKI  275 (296)
T ss_pred             HHHCcCCcccCc-CHHHHhhChhhhc
Confidence            467888999995 6899999999973


No 150
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=73.66  E-value=0.83  Score=30.97  Aligned_cols=28  Identities=18%  Similarity=0.172  Sum_probs=22.4

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCCh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDW   30 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW   30 (100)
                      ++.+.++|..|. .+.+|..|+||....-
T Consensus       234 ~~~l~~~p~~Rp-~~~~il~~~~~~~~~~  261 (277)
T cd06640         234 DACLNKDPSFRP-TAKELLKHKFIVKNAK  261 (277)
T ss_pred             HHHcccCcccCc-CHHHHHhChHhhhcch
Confidence            457788999996 6799999999975544


No 151
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=72.71  E-value=0.75  Score=31.74  Aligned_cols=25  Identities=16%  Similarity=0.258  Sum_probs=20.9

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.+..+|..|. .+.+|..|+||+.
T Consensus       250 ~~~l~~dp~~Rp-t~~~il~~~~~~~  274 (296)
T cd06655         250 NRCLEMDVEKRG-SAKELLQHPFLKL  274 (296)
T ss_pred             HHHhhcChhhCC-CHHHHhhChHhhh
Confidence            467888999995 7899999999973


No 152
>KOG0660|consensus
Probab=72.63  E-value=1  Score=33.00  Aligned_cols=27  Identities=19%  Similarity=0.376  Sum_probs=22.9

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      |+|.|.-+|.+|+ .++|-.+|||++.+
T Consensus       290 lekmL~fdP~kRi-ta~eAL~hPYl~~~  316 (359)
T KOG0660|consen  290 LEKMLVFDPKKRI-TAEEALAHPYLAPY  316 (359)
T ss_pred             HHHHhccCccccC-CHHHHhcChhhhhh
Confidence            4678899999997 68999999999744


No 153
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=71.41  E-value=1.2  Score=30.68  Aligned_cols=24  Identities=21%  Similarity=0.553  Sum_probs=20.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      ++.+..+|..|. .+++|..|+||.
T Consensus       252 ~~~l~~~P~~Rp-s~~~ll~~~~~~  275 (297)
T cd06659         252 ERMLTREPQERA-TAQELLDHPFLL  275 (297)
T ss_pred             HHHhcCCcccCc-CHHHHhhChhhc
Confidence            456788899986 589999999986


No 154
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=71.26  E-value=1.1  Score=30.88  Aligned_cols=25  Identities=24%  Similarity=0.340  Sum_probs=20.5

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.+..+|..|. .+.+|..|+||..
T Consensus       248 ~~~l~~~p~~Rp-~~~~il~~~~~~~  272 (307)
T cd06607         248 DSCLQKIPQDRP-SSEELLKHRFVLR  272 (307)
T ss_pred             HHHhcCChhhCc-CHHHHhcChhhcc
Confidence            456788899986 6899999999973


No 155
>KOG0599|consensus
Probab=70.55  E-value=0.83  Score=32.95  Aligned_cols=26  Identities=23%  Similarity=0.477  Sum_probs=21.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      +++|.-+|.+|+ .++|..+||||..+
T Consensus       264 srlLqVdp~~Ri-take~LaHpff~q~  289 (411)
T KOG0599|consen  264 SRLLQVDPTKRI-TAKEALAHPFFIQI  289 (411)
T ss_pred             HHHHeeCchhcc-cHHHHhcChHHHHH
Confidence            567888999997 67999999999644


No 156
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=70.08  E-value=1.6  Score=30.25  Aligned_cols=25  Identities=20%  Similarity=0.267  Sum_probs=21.1

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      ++.+.++|..|. .+++|..|+|+..
T Consensus       248 ~~cl~~~P~~Rp-~~~~ll~~~~~~~  272 (308)
T cd06634         248 DSCLQKIPQDRP-TSEVLLKHRFVLR  272 (308)
T ss_pred             HHHhhCCcccCC-CHHHHhhCccccc
Confidence            467788999996 5899999999975


No 157
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=69.09  E-value=0.53  Score=31.88  Aligned_cols=29  Identities=21%  Similarity=0.231  Sum_probs=22.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWT   31 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~   31 (100)
                      .+.+.++|..|. .+.+|..|+||....+.
T Consensus       234 ~~~l~~~p~~Rp-~~~~il~~~~~~~~~~~  262 (277)
T cd06642         234 EACLNKDPRFRP-TAKELLKHKFITRYTKK  262 (277)
T ss_pred             HHHccCCcccCc-CHHHHHHhHHHHHHhhh
Confidence            456778889985 78999999999766554


No 158
>KOG4717|consensus
Probab=68.15  E-value=1.5  Score=34.25  Aligned_cols=30  Identities=10%  Similarity=0.173  Sum_probs=24.5

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChhH
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWTQ   32 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~~   32 (100)
                      +..|.++|.+|. ..++|..|+|.+++|=..
T Consensus       251 ~sMLvRdPkkRA-slEeI~s~~Wlq~~D~~~  280 (864)
T KOG4717|consen  251 QSMLVRDPKKRA-SLEEIVSTSWLQAGDRGL  280 (864)
T ss_pred             HHHHhcCchhhc-cHHHHhccccccCCCCCc
Confidence            445778888885 789999999999998643


No 159
>KOG1027|consensus
Probab=67.99  E-value=2.5  Score=34.39  Aligned_cols=24  Identities=21%  Similarity=0.405  Sum_probs=20.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      .+.+..+|..|. .+.+|..||||-
T Consensus       748 ~~ml~~dP~~RP-sa~~VL~HPlFW  771 (903)
T KOG1027|consen  748 SRMLNPDPQLRP-SATDVLNHPLFW  771 (903)
T ss_pred             HHhcCCCcccCC-CHHHHhCCCccC
Confidence            456788888886 689999999995


No 160
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=67.72  E-value=1.7  Score=29.49  Aligned_cols=24  Identities=17%  Similarity=0.254  Sum_probs=19.7

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      ++.+.++|..|. .+.||..|+||.
T Consensus       247 ~~~l~~dp~~Rp-t~~e~~~~~~~~  270 (284)
T cd06620         247 DACLLKDPTERP-TPQQLCAMPPFI  270 (284)
T ss_pred             HHHhcCCcccCc-CHHHHhcCcccc
Confidence            456778899996 679999999985


No 161
>KOG0663|consensus
Probab=66.59  E-value=2.4  Score=31.32  Aligned_cols=27  Identities=15%  Similarity=0.263  Sum_probs=22.7

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      |.++|+-+|++|+ .+++-..|.||+..
T Consensus       341 ln~llt~dP~kR~-tA~~~L~h~~F~e~  367 (419)
T KOG0663|consen  341 LNKLLTYDPGKRI-TAEDGLKHEYFRET  367 (419)
T ss_pred             HHHHhccCccccc-cHHHhhcccccccC
Confidence            4578999999997 67899999999853


No 162
>KOG0666|consensus
Probab=66.39  E-value=1.8  Score=31.83  Aligned_cols=26  Identities=31%  Similarity=0.607  Sum_probs=22.3

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      |+|+|+-||-+|. .+++-++|+||..
T Consensus       317 L~klL~yDP~kRI-ta~qAleh~yF~~  342 (438)
T KOG0666|consen  317 LQKLLTYDPIKRI-TAEQALEHPYFTE  342 (438)
T ss_pred             HHHHhccCchhhc-cHHHHhccccccc
Confidence            5688999999997 5788999999974


No 163
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=65.37  E-value=1.3  Score=29.94  Aligned_cols=24  Identities=21%  Similarity=0.304  Sum_probs=19.8

Q ss_pred             CccCCCCCcccCChhhhhcCCCCCC
Q psy10             3 KHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         3 k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      +.+..+|..|. ++.+|..||||..
T Consensus       235 ~~l~~~p~~Rp-~~~~~l~~~~~~~  258 (277)
T cd06641         235 ACLNKEPSFRP-TAKELLKHKFIVR  258 (277)
T ss_pred             HHccCChhhCc-CHHHHHhCHHHhh
Confidence            45778888885 6899999999974


No 164
>KOG0607|consensus
Probab=56.40  E-value=2.2  Score=31.46  Aligned_cols=29  Identities=14%  Similarity=0.171  Sum_probs=23.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCChh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDWT   31 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW~   31 (100)
                      +++|.+++.+|+ .+..|.+|||+.++-=+
T Consensus       342 snLlvrda~~rl-sa~~vlnhPw~~~~~~e  370 (463)
T KOG0607|consen  342 SNLLVRDAKQRL-SAAQVLNHPWVQRCAPE  370 (463)
T ss_pred             HHHHhccHHhhh-hhhhccCCccccccchh
Confidence            457788888887 57899999999987655


No 165
>KOG0578|consensus
Probab=54.61  E-value=2.9  Score=32.33  Aligned_cols=25  Identities=24%  Similarity=0.405  Sum_probs=20.6

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      |.+.|..++.+|. .+.|+.+||||+
T Consensus       503 L~~cL~~dv~~Ra-sA~eLL~HpFl~  527 (550)
T KOG0578|consen  503 LDRCLVVDVEQRA-SAKELLEHPFLK  527 (550)
T ss_pred             HHHHhhcchhcCC-CHHHHhcChhhh
Confidence            3467888899985 689999999994


No 166
>KOG0594|consensus
Probab=53.16  E-value=4.6  Score=29.32  Aligned_cols=26  Identities=23%  Similarity=0.438  Sum_probs=21.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      .+.|.-+|.+|. .+.....||||..+
T Consensus       283 ~~~L~y~p~~R~-Sa~~al~h~yf~~~  308 (323)
T KOG0594|consen  283 SKLLQYDPAKRI-SAKGALTHPYFSEL  308 (323)
T ss_pred             HHHhccCcccCc-CHHHHhcChhhccc
Confidence            456777888886 67889999999977


No 167
>KOG0033|consensus
Probab=51.18  E-value=4.1  Score=29.07  Aligned_cols=27  Identities=19%  Similarity=0.389  Sum_probs=21.7

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      +|-|..||.+|. .+.|-.+|||.++-+
T Consensus       248 rrML~~dP~kRI-ta~EAL~HpWi~~r~  274 (355)
T KOG0033|consen  248 RRMLTVNPKKRI-TADEALKHPWICNRE  274 (355)
T ss_pred             HHHhccChhhhc-cHHHHhCCchhcchH
Confidence            467888999997 578889999997543


No 168
>KOG0667|consensus
Probab=51.02  E-value=4.9  Score=31.44  Aligned_cols=29  Identities=21%  Similarity=0.424  Sum_probs=23.0

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCCCCh
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTGLDW   30 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~idW   30 (100)
                      |.+.|.-+|..|. .+.+.++||||.+.--
T Consensus       482 lk~~L~~dP~~R~-tp~qal~Hpfl~~~~~  510 (586)
T KOG0667|consen  482 LKRCLEWDPAERI-TPAQALNHPFLTGTSL  510 (586)
T ss_pred             HHHHhccCchhcC-CHHHHhcCcccccccc
Confidence            3567888999996 6789999999995543


No 169
>KOG0597|consensus
Probab=48.78  E-value=3  Score=33.00  Aligned_cols=25  Identities=28%  Similarity=0.482  Sum_probs=20.7

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      +-+|.|+|++|+.. .++..|||.++
T Consensus       232 ~gLL~kdP~~RltW-~~Ll~HpF~k~  256 (808)
T KOG0597|consen  232 QGLLIKDPAQRLTW-TDLLGHPFWKG  256 (808)
T ss_pred             HHHhhcChhhcccH-HHHhcChHHhh
Confidence            45789999999854 68899999984


No 170
>KOG0668|consensus
Probab=47.90  E-value=3.1  Score=29.41  Aligned_cols=25  Identities=20%  Similarity=0.339  Sum_probs=18.1

Q ss_pred             CccCCCCCcccCChhhhhcCCCCCCC
Q psy10             3 KHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         3 k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      |+|.-+=..|+ .+.|-|.||||..+
T Consensus       304 klLrYDHqeRl-TakEam~HpyF~~~  328 (338)
T KOG0668|consen  304 KLLRYDHQERL-TAKEAMAHPYFAPV  328 (338)
T ss_pred             HHHhhcccccc-chHHHhcCchHHHH
Confidence            45555566665 57899999999754


No 171
>KOG0198|consensus
Probab=47.41  E-value=5.6  Score=28.67  Aligned_cols=26  Identities=27%  Similarity=0.548  Sum_probs=21.6

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      |.+.+.++|..|. .++++..|||...
T Consensus       256 l~~C~~~~p~~Rp-ta~eLL~hpf~~~  281 (313)
T KOG0198|consen  256 LRKCFKRDPEKRP-TAEELLEHPFLKQ  281 (313)
T ss_pred             HHHHhhcCcccCc-CHHHHhhChhhhc
Confidence            4577889999985 7899999999864


No 172
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=47.10  E-value=5.3  Score=27.72  Aligned_cols=24  Identities=25%  Similarity=0.347  Sum_probs=19.4

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      ++.+.++|..|. .+.+|..|+|+.
T Consensus       258 ~~~l~~~p~~Rp-t~~~il~~~~~~  281 (317)
T cd06635         258 DSCLQKIPQDRP-TSEELLKHMFVL  281 (317)
T ss_pred             HHHccCCcccCc-CHHHHHhChhhh
Confidence            356778888886 689999999984


No 173
>PLN00181 protein SPA1-RELATED; Provisional
Probab=45.97  E-value=6.6  Score=31.35  Aligned_cols=24  Identities=13%  Similarity=0.094  Sum_probs=20.0

Q ss_pred             CccCCCCCcccCChhhhhcCCCCCC
Q psy10             3 KHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         3 k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      +.|.++|..|. .+.+|..||||..
T Consensus       247 ~~L~~~P~~Rp-s~~eil~h~~~~~  270 (793)
T PLN00181        247 WLLHPEPSCRP-SMSELLQSEFINE  270 (793)
T ss_pred             HhCCCChhhCc-ChHHHhhchhhhh
Confidence            45778898886 6899999999975


No 174
>KOG0669|consensus
Probab=45.17  E-value=5.6  Score=28.53  Aligned_cols=24  Identities=25%  Similarity=0.365  Sum_probs=20.0

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      .++|+.||.+|+ .+.++.+|-||.
T Consensus       296 e~ll~~DP~kR~-~ad~alnh~~F~  319 (376)
T KOG0669|consen  296 EKLLKLDPTKRI-DADQALNHDFFW  319 (376)
T ss_pred             HHHhccCcccCc-chHhhhchhhhh
Confidence            357888999997 568999999996


No 175
>KOG0658|consensus
Probab=44.95  E-value=4.5  Score=29.76  Aligned_cols=24  Identities=29%  Similarity=0.447  Sum_probs=19.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      .+.|.-+|..|+ .+.++..||||.
T Consensus       287 ~~~L~Y~P~~R~-~~~~~l~h~fFd  310 (364)
T KOG0658|consen  287 SKLLQYSPSKRL-SALEALAHPFFD  310 (364)
T ss_pred             HHHhccChhhcC-CHHHHhcchhhH
Confidence            467788899997 458899999995


No 176
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=44.61  E-value=4.2  Score=30.72  Aligned_cols=26  Identities=12%  Similarity=0.177  Sum_probs=20.8

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ++.|..+|..|+ .+.+|..|||++.+
T Consensus       278 ~~~L~~dP~~RP-s~~ell~~p~~~~~  303 (496)
T PTZ00283        278 TALLSSDPKRRP-SSSKLLNMPICKLF  303 (496)
T ss_pred             HHHcccChhhCc-CHHHHHhCHHHHHh
Confidence            456788899987 57899999998753


No 177
>KOG0659|consensus
Probab=44.61  E-value=6.6  Score=28.17  Aligned_cols=25  Identities=20%  Similarity=0.490  Sum_probs=21.1

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      |++.+.-+|.+|+ .+.+...|+||+
T Consensus       261 l~~m~~ynP~~Ri-ta~qaL~~~yf~  285 (318)
T KOG0659|consen  261 LSKMLTYNPKKRI-TASQALKHPYFK  285 (318)
T ss_pred             HHhhhccCchhcc-cHHHHhcchhhh
Confidence            4567888999997 678999999997


No 178
>KOG0661|consensus
Probab=41.96  E-value=8.9  Score=29.53  Aligned_cols=24  Identities=25%  Similarity=0.475  Sum_probs=19.5

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      .++++=||.+|. .+.+..+||||.
T Consensus       272 ~~ll~WDP~kRp-TA~~al~~pffq  295 (538)
T KOG0661|consen  272 ERLLAWDPDKRP-TASQALQHPFFQ  295 (538)
T ss_pred             HHHhcCCCccCc-cHHHHhcCcccc
Confidence            356677888886 578999999997


No 179
>KOG0596|consensus
Probab=40.78  E-value=9.2  Score=30.12  Aligned_cols=26  Identities=23%  Similarity=0.295  Sum_probs=20.9

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      ...|++||.+|. .+.++.+|||...+
T Consensus       608 K~CL~rdPkkR~-si~eLLqhpFl~~~  633 (677)
T KOG0596|consen  608 KCCLARDPKKRW-SIPELLQHPFLQIQ  633 (677)
T ss_pred             HHHHhcCcccCC-CcHHHhcCcccccc
Confidence            456888899886 57899999998753


No 180
>KOG4038|consensus
Probab=32.72  E-value=23  Score=22.21  Aligned_cols=25  Identities=24%  Similarity=0.380  Sum_probs=19.3

Q ss_pred             cccCCcccCC---CHHHHHHHHhCCCCC
Q psy10            76 DLYKNFPLTI---SERLAEFRRFAPESR  100 (100)
Q Consensus        76 ~~F~~Fsy~~---~~~~~~~~~~~~~~~  100 (100)
                      +.|-+|-|+.   -..||++...|+||.
T Consensus        89 ewffefgfvipnstntwqs~ieaapesq  116 (150)
T KOG4038|consen   89 EWFFEFGFVIPNSTNTWQSTIEAAPESQ  116 (150)
T ss_pred             HhhhhhceeccCCcchHHHHHhhCchhc
Confidence            4566777763   367999999999983


No 181
>KOG0590|consensus
Probab=30.71  E-value=14  Score=29.02  Aligned_cols=27  Identities=4%  Similarity=0.206  Sum_probs=22.7

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      .+.|.-+|.+|. .+++|.+-+||+.|+
T Consensus       566 ~~~l~~~P~~R~-ti~~i~~d~W~~~i~  592 (601)
T KOG0590|consen  566 YRMLQLDPTKRI-TIEQILNDEWIRSIE  592 (601)
T ss_pred             HHHccCChhhee-cHHHHhhChHhhhcc
Confidence            467888999996 579999999998765


No 182
>KOG0983|consensus
Probab=29.35  E-value=26  Score=25.54  Aligned_cols=25  Identities=20%  Similarity=0.409  Sum_probs=17.1

Q ss_pred             ccCCCCCcccCChhhhhcCCCCCCCC
Q psy10             4 HKAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         4 ~l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      .|.|++..|. -..++++|||.+..+
T Consensus       332 CL~kd~r~RP-~Y~~Ll~h~Fi~~ye  356 (391)
T KOG0983|consen  332 CLTKDHRKRP-KYNKLLEHPFIKRYE  356 (391)
T ss_pred             HhhcCcccCc-chHHHhcCcceeecc
Confidence            4556666664 356899999997553


No 183
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=26.90  E-value=10  Score=28.36  Aligned_cols=26  Identities=12%  Similarity=0.208  Sum_probs=20.4

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      .+.|.++|..|. ++.++..|+|++.+
T Consensus       304 ~~~L~~dP~~Rp-s~~~~l~~~~~~~~  329 (478)
T PTZ00267        304 DPLLSKNPALRP-TTQQLLHTEFLKYV  329 (478)
T ss_pred             HHHhccChhhCc-CHHHHHhCHHHHHH
Confidence            466788899986 57889999998643


No 184
>PF14623 Vint:  Hint-domain
Probab=26.81  E-value=23  Score=23.25  Aligned_cols=11  Identities=36%  Similarity=0.933  Sum_probs=10.2

Q ss_pred             hhhhcCCCCCC
Q psy10            17 DEVKEHPFFTG   27 (100)
Q Consensus        17 ~eIk~HpfF~~   27 (100)
                      ++|.+|+||-+
T Consensus       118 ~dvraH~fFG~  128 (162)
T PF14623_consen  118 EDVRAHAFFGD  128 (162)
T ss_pred             CcEEeecccCc
Confidence            79999999987


No 185
>KOG0586|consensus
Probab=26.72  E-value=25  Score=27.68  Aligned_cols=26  Identities=12%  Similarity=0.235  Sum_probs=21.4

Q ss_pred             CCCccCCCCCcccCChhhhhcCCCCCC
Q psy10             1 MPKHKAKTPIQQQLRSDEVKEHPFFTG   27 (100)
Q Consensus         1 l~k~l~k~p~~r~~g~~eIk~HpfF~~   27 (100)
                      |+|.|..+|.+|. ..++||.|.|-..
T Consensus       286 Lrk~lvl~Pskr~-~~dqim~~~W~n~  311 (596)
T KOG0586|consen  286 LRKFLVLNPSKRG-PCDQIMKDRWRND  311 (596)
T ss_pred             HHHhhccCccccC-CHHHhhhhcccch
Confidence            5677889999984 6799999999863


No 186
>PF14684 Tricorn_C1:  Tricorn protease C1 domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A.
Probab=25.41  E-value=6  Score=21.87  Aligned_cols=12  Identities=42%  Similarity=1.057  Sum_probs=9.6

Q ss_pred             CCCCChhHHhcC
Q psy10            25 FTGLDWTQVYMQ   36 (100)
Q Consensus        25 F~~idW~~l~~k   36 (100)
                      |.|+||+++..+
T Consensus        24 ~~gvDW~~~~~~   35 (70)
T PF14684_consen   24 MHGVDWDAVYDR   35 (70)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             CCCCChHHHHHH
Confidence            368999998875


No 187
>KOG0600|consensus
Probab=23.09  E-value=29  Score=27.03  Aligned_cols=24  Identities=17%  Similarity=0.261  Sum_probs=20.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCC
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFT   26 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~   26 (100)
                      .++|+.+|.+|. .+.+...|.||.
T Consensus       381 ~~lL~ldP~kR~-tA~~aL~seyF~  404 (560)
T KOG0600|consen  381 EKLLSLDPDKRG-TASSALQSEYFT  404 (560)
T ss_pred             HHHhccCccccc-cHHHHhcCcccc
Confidence            468999999994 688999999994


No 188
>PF03790 KNOX1:  KNOX1 domain ;  InterPro: IPR005540 The MEINOX region is comprised of two domains, KNOX1 and KNOX2. KNOX1 plays a role in suppressing target gene expression. KNOX2, essential for function, is thought to be necessary for homo-dimerization [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=22.53  E-value=27  Score=17.89  Aligned_cols=25  Identities=24%  Similarity=0.400  Sum_probs=14.2

Q ss_pred             hhhhcCCCCCCCChhHHhcCcCCCC
Q psy10            17 DEVKEHPFFTGLDWTQVYMQKYTPP   41 (100)
Q Consensus        17 ~eIk~HpfF~~idW~~l~~k~~~pP   41 (100)
                      ..|..||.|..+==.-+..+++-+|
T Consensus         5 A~I~~HP~Y~~Ll~Ayi~C~KVGAP   29 (45)
T PF03790_consen    5 AKIASHPLYPRLLAAYIDCQKVGAP   29 (45)
T ss_pred             HHHHcCCCcHHHHHHHHHHHhcCCC
Confidence            4788999886443333444444443


No 189
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=21.48  E-value=19  Score=30.22  Aligned_cols=28  Identities=0%  Similarity=-0.126  Sum_probs=22.6

Q ss_pred             CCccCCCCCcccCChhhhhcCCCCCCCCh
Q psy10             2 PKHKAKTPIQQQLRSDEVKEHPFFTGLDW   30 (100)
Q Consensus         2 ~k~l~k~p~~r~~g~~eIk~HpfF~~idW   30 (100)
                      +++|..+|..|+ .+.++..|+|++.+..
T Consensus       276 ~~~L~~dPeeRP-Sa~QlL~h~~ik~i~~  303 (1021)
T PTZ00266        276 KNLLNLSAKERP-SALQCLGYQIIKNVGP  303 (1021)
T ss_pred             HHHhcCChhHCc-CHHHHhccHHHhhcCC
Confidence            457888899986 6789999999987654


No 190
>KOG1290|consensus
Probab=20.80  E-value=59  Score=25.45  Aligned_cols=24  Identities=13%  Similarity=0.325  Sum_probs=17.8

Q ss_pred             cCCCCCcccCChhhhhcCCCCCCCC
Q psy10             5 KAKTPIQQQLRSDEVKEHPFFTGLD   29 (100)
Q Consensus         5 l~k~p~~r~~g~~eIk~HpfF~~id   29 (100)
                      |.-+|.+|. .+.+...|||+..+-
T Consensus       534 Lef~PeKR~-tA~~cl~hPwLn~~~  557 (590)
T KOG1290|consen  534 LEFDPEKRP-TAAQCLKHPWLNPVA  557 (590)
T ss_pred             HhcCccccc-cHHHHhcCccccCCC
Confidence            455677775 567889999998653


No 191
>PF03720 UDPG_MGDP_dh_C:  UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain;  InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]. The enzymes have a wide range of functions. In plants UDP-glucose dehydrogenase, 1.1.1.22 from EC, is an important enzyme in the synthesis of hemicellulose and pectin [], which are the components of newly formed cell walls; while in zebrafish UDP-glucose dehydrogenase is required for cardiac valve formation []. In Xanthomonas campestris, a plant pathogen, UDP-glucose dehydrogenase is required for virulence [].  GDP-mannose dehydrogenase, 1.1.1.132 from EC, catalyses the formation of GDP-mannuronic acid, which is the monomeric unit from which the exopolysaccharide alginate is formed. Alginate is secreted by a number of bacteria, which include Pseudomonas aeruginosa and Azotobacter vinelandii. In P. aeruginosa, alginate is believed to play an important role in the bacteria's resistance to antibiotics and the host immune response [], while in A. vinelandii it is essential for the encystment process []. This entry represents the C-terminal substrate-binding domain of these enzymes. Structural studies indicate that this domain forms an incomplete dinucleotide binding fold [, ].; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0051287 NAD binding, 0055114 oxidation-reduction process; PDB: 3GG2_D 1DLI_A 1DLJ_A 2Y0E_D 2Y0D_B 2Y0C_D 1MV8_B 1MUU_A 1MFZ_C 3TDK_B ....
Probab=20.73  E-value=25  Score=20.75  Aligned_cols=25  Identities=32%  Similarity=0.639  Sum_probs=16.8

Q ss_pred             hcCCCCCCCChhHHhcCcCCCCccC
Q psy10            20 KEHPFFTGLDWTQVYMQKYTPPLIP   44 (100)
Q Consensus        20 k~HpfF~~idW~~l~~k~~~pP~~P   44 (100)
                      ..|+-|+.++|+.+......++++-
T Consensus        74 t~h~~f~~l~~~~~~~~~~~~~~ii   98 (106)
T PF03720_consen   74 TDHDEFRELDWEEIAKLMRKPPVII   98 (106)
T ss_dssp             S--GGGGCCGHHHHHHHSCSSEEEE
T ss_pred             ecCHHHhccCHHHHHHhcCCCCEEE
Confidence            6899999999998876543555543


No 192
>KOG0201|consensus
Probab=20.51  E-value=31  Score=26.29  Aligned_cols=24  Identities=21%  Similarity=0.291  Sum_probs=20.3

Q ss_pred             ccCCCCCcccCChhhhhcCCCCCCC
Q psy10             4 HKAKTPIQQQLRSDEVKEHPFFTGL   28 (100)
Q Consensus         4 ~l~k~p~~r~~g~~eIk~HpfF~~i   28 (100)
                      +|.|+|..|. .+.++..|+|.+..
T Consensus       246 CL~k~P~~Rp-sA~~LLKh~FIk~a  269 (467)
T KOG0201|consen  246 CLDKNPEFRP-SAKELLKHKFIKRA  269 (467)
T ss_pred             HhhcCcccCc-CHHHHhhhHHHHhc
Confidence            5788999996 68899999999863


Done!