Diaphorina citri psyllid: psy10018

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680
MSQTEVPVLFSGLLCCCDICPESNHTCETDGYCFTSTFLDKATGVISYNYRCLDKQLIYPPENPILCHSAHTLNDTFVIECCKEVDLCNENLRPQLFKPKIPEGKPWLIPSGSLGTWELAMLIAGPIGMICLAFMLGVSFWSQHKKKLLSHSRFRCEPGGEDAADQPILGPSPPSLNEMIRDKRGLLCCCDICPESNHTCETDGYCFTSTFLDKATGVISYNYRCLDKQLIYPPENPILCHSAHTLNDTFVIECCKEVDLCNENLRPQLFKPKIPEVENESILDDSKPAIAHRDLKSKNILVRSNGTCAIGDLGLAVRHDITSDTVDIPLNNRVGTKRYMAPEVLEESMNMSHFDAFKRGDVYAFGLILWEMARRCNVGGLYDDTDVKLDTNITQRNPAVPRKNFICLVRDNQMTTSGSGSGLPLLVQRSIARQIQLVETIGKGRFGEVWRGRWRGENVAVKIFSSREERSWFREAEIYQTVMLRHDNILGFIAADNKGLVDPTIDEMRKVVCLDQIRPAIPNRWHACKDLHLVLKIMQECWYPVATARPTALRIKKTIASIILSDQADLHLVLKIMQECWYPVATARPTALRIKKTIASIILSDQATLHIMSKVMKECWYHNNGTWTQLWLITDYHANGSLFDFLNRSTIDVPGMIKMALSIATGLAHLHMEIVGTQEV
ccccccccccccCEEEccccccccccccccccEEEEEEEEccccEEEEEccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccCEEEEEECccccccEEEEccEEEEEECccccccEEEEEECcccccccccccccEEECccccccccEEEEEEcccHHHHHHcccccccccccccccccccccccccCCccccccccEEEccccCEEEcccccccccccccccccccccccccccccccHHHHHHcccccccccccccEEEHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccEEEEEcccccccCCcccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHccccccccHHHccEEEEEccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccHHHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccCEEEEEEEcccccccHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccc
*****VPVLFSGLLCCCDICPESNHTCETDGYCFTSTFLDKATGVISYNYRCLDKQLIYPPENPILCHSAHTLNDTFVIECCKEVDLCNENLRPQLFKPKIPEGKPWLIPSGSLGTWELAMLIAGPIGMICLAFMLGVSFWSQHKK*****************************LNEMIRDKRGLLCCCDICPESNHTCETDGYCFTSTFLDKATGVISYNYRCLDKQLIYPPENPILCHSAHTLNDTFVIECCKEVDLCNENLRPQLFKPKIPEVENESILDDSKPAIAHRDLKSKNILVRSNGTCAIGDLGLAVRHDITSDTVDIPLNNRVGTKRYMAPEVLEESMNMSHFDAFKRGDVYAFGLILWEMARRCNVGGLYDDTDVKLDTNITQRNPAVPRKNFICLVRDNQMTTSGSGSGLPLLVQRSIARQIQLVETIGKGRFGEVWRGRWRGENVAVKIFSSREERSWFREAEIYQTVMLRHDNILGFIAADNKGLVDPTIDEMRKVVCLDQIRPAIPNRWHACKDLHLVLKIMQECWYPVATARPTALRIKKTIASIILSDQADLHLVLKIMQECWYPVATARPTALRIKKTIASIILSDQATLHIMSKVMKECWYHNNGTWTQLWLITDYHANGSLFDFLNRSTIDVPGMIKMALSIATGLAHLHMEIVG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQTEVPVLFSGLLCCCDICPESNHTCETDGYCFTSTFLDKATGVISYNYRCLDKQLIYPPENPILCHSAHTLNDTFVIECCKEVDLCNENLRPQLFKPKIPEGKPWLIPSGSLGTWELAMLIAGPIGMICLAFMLGVSFWSQHKKKLLSHSRFRCEPGGEDAADQPILGPSPPSLNEMIRDKRGLLCCCDICPESNHTCETDGYCFTSTFLDKATGVISYNYRCLDKQLIYPPENPILCHSAHTLNDTFVIECCKEVDLCNENLRPQLFKPKIPEVENESILDDSKPAIAHRDLKSKNILVRSNGTCAIGDLGLAVRHDITSDTVDIPLNNRVGTKRYMAPEVLEESMNMSHFDAFKRGDVYAFGLILWEMARRCNVGGLYDDTDVKLDTNITQRNPAVPRKNFICLVRDNQMTTSGSGSGLPLLVQRSIARQIQLVETIGKGRFGEVWRGRWRGENVAVKIFSSREERSWFREAEIYQTVMLRHDNILGFIAADNKGLVDPTIDEMRKVVCLDQIRPAIPNRWHACKDLHLVLKIMQECWYPVATARPTALRIKKTIASIILSDQADLHLVLKIMQECWYPVATARPTALRIKKTIASIILSDQATLHIMSKVMKECWYHNNGTWTQLWLITDYHANGSLFDFLNRSTIDVPGMIKMALSIATGLAHLHMEIVGTQEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004672 [MF]protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0016020 [CC]membraneprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B6C, chain B
Confidence level:very confident
Coverage over the Query: 412-498,623-678
View the alignment between query and template
View the model in PyMOL
Template: 3MDY, chain A
Confidence level:very confident
Coverage over the Query: 202-385,422-425,480-481,498-567
View the alignment between query and template
View the model in PyMOL
Template: 2L5S, chain A
Confidence level:very confident
Coverage over the Query: 10-95
View the alignment between query and template
View the model in PyMOL
Template: 3MTF, chain A
Confidence level:confident
Coverage over the Query: 287-405
View the alignment between query and template
View the model in PyMOL
Template: 4DYM, chain A
Confidence level:probable
Coverage over the Query: 287-405
View the alignment between query and template
View the model in PyMOL