RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy10024
(69 letters)
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 3. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 3 (FGFR3); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR3 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. Many FGFR3 splice
variants have been reported with the IIIb and IIIc
isoforms being the predominant forms. FGFR3 IIIc is the
isoform expressed in chondrocytes, the cells affected in
dwarfism, while IIIb is expressed in epithelial cells.
FGFR3 ligands include FGF1, FGF2, FGF4, FGF8, FGF9, and
FGF23. It is a negative regulator of long bone growth.
In the cochlear duct and in the lens, FGFR3 is involved
in differentiation while it appears to have a role in
cell proliferation in epithelial cells. Germline
mutations in FGFR3 are associated with skeletal
disorders including several forms of dwarfism. Some
missense mutations are associated with multiple myeloma
and carcinomas of the bladder and cervix. Overexpression
of FGFR3 is found in thyroid carcinoma.
Length = 334
Score = 28.8 bits (64), Expect = 0.17
Identities = 10/20 (50%), Positives = 14/20 (70%)
Query: 25 HLVLKIMQECWYPVATARPT 44
H + IM+ECW+ V + RPT
Sbjct: 263 HELYMIMRECWHAVPSQRPT 282
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine
Kinases, Met and Ron. Protein Tyrosine Kinase (PTK)
family; Met and Ron; catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Met and
Ron are receptor tyr kinases (RTKs) composed of an
alpha-beta heterodimer. The extracellular alpha chain is
disulfide linked to the beta chain, which contains an
extracellular ligand-binding region with a sema domain,
a PSI domain and four IPT repeats, a transmembrane
segment, and an intracellular catalytic domain. Binding
to their ligands leads to receptor dimerization,
autophosphorylation, activation, and intracellular
signaling. Met binds to the ligand, hepatocyte growth
factor/scatter factor (HGF/SF), and is also called the
HGF receptor. HGF/Met signaling plays a role in growth,
transformation, cell motility, invasion, metastasis,
angiogenesis, wound healing, and tissue regeneration.
Aberrant expression of Met through mutations or gene
amplification is associated with many human cancers
including hereditary papillary renal and gastric
carcinomas. The ligand for Ron is macrophage stimulating
protein (MSP). Ron signaling is important in regulating
cell motility, adhesion, proliferation, and apoptosis.
Aberrant Ron expression is implicated in tumorigenesis
and metastasis.
Length = 262
Score = 28.6 bits (64), Expect = 0.20
Identities = 9/29 (31%), Positives = 13/29 (44%)
Query: 30 IMQECWYPVATARPTALRIKKTIASIILS 58
+M CW+P RPT + I I +
Sbjct: 234 VMLSCWHPKPEMRPTFSELVSRIEQIFST 262
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 4. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 4 (FGFR4); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR4 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. Unlike other FGFRs,
there is only one splice form of FGFR4. It binds FGF1,
FGF2, FGF6, FGF19, and FGF23. FGF19 is a selective
ligand for FGFR4. Although disruption of FGFR4 in mice
causes no obvious phenotype, in vivo inhibition of FGFR4
in cultured skeletal muscle cells resulted in an arrest
of muscle progenitor differentiation. FGF6 and FGFR4 are
uniquely expressed in myofibers and satellite cells.
FGF6/FGFR4 signaling appears to play a key role in the
regulation of muscle regeneration. A polymorphism in
FGFR4 is found in head and neck squamous cell carcinoma.
Length = 314
Score = 28.0 bits (62), Expect = 0.28
Identities = 10/20 (50%), Positives = 14/20 (70%)
Query: 25 HLVLKIMQECWYPVATARPT 44
H + +M+ECW+ V T RPT
Sbjct: 263 HELYMLMRECWHAVPTQRPT 282
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase,
C-terminal Src kinase. Protein Tyrosine Kinase (PTK)
family; C-terminal Src kinase (Csk); catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. The Csk
subfamily kinases are cytoplasmic (or nonreceptor) tyr
kinases containing the Src homology domains, SH3 and
SH2, N-terminal to the catalytic tyr kinase domain. They
negatively regulate the activity of Src kinases that are
anchored to the plasma membrane. To inhibit Src kinases,
Csk is translocated to the membrane via binding to
specific transmembrane proteins, G-proteins, or adaptor
proteins near the membrane. Csk catalyzes the tyr
phosphorylation of the regulatory C-terminal tail of Src
kinases, resulting in their inactivation. Csk is
expressed in a wide variety of tissues. As a negative
regulator of Src, Csk plays a role in cell
proliferation, survival, and differentiation, and
consequently, in cancer development and progression. In
addition, Csk also shows Src-independent functions. It
is a critical component in G-protein signaling, and
plays a role in cytoskeletal reorganization and cell
migration.
Length = 256
Score = 27.3 bits (60), Expect = 0.46
Identities = 9/30 (30%), Positives = 20/30 (66%)
Query: 26 LVLKIMQECWYPVATARPTALRIKKTIASI 55
+V +M++CW+ A RP+ L++++ + I
Sbjct: 227 VVYDVMKQCWHLDAATRPSFLQLREQLEHI 256
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine
Kinases, Platelet Derived Growth Factor Receptors.
Protein Tyrosine Kinase (PTK) family; Platelet Derived
Growth Factor Receptor (PDGFR) subfamily; catalytic (c)
domain. The PDGFR subfamily consists of PDGFR alpha,
PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar
proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of other
kinases such as protein serine/threonine kinases, RIO
kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to tyrosine (tyr) residues in protein substrates.
PDGFR subfamily members are receptor tyr kinases (RTKs)
containing an extracellular ligand-binding region with
five immunoglobulin-like domains, a transmembrane
segment, and an intracellular catalytic domain. PDGFR
kinase domains are autoinhibited by their juxtamembrane
regions containing tyr residues. The binding to their
ligands leads to receptor dimerization, trans
phosphorylation and activation, and intracellular
signaling. PDGFR subfamily receptors are important in
the development of a variety of cells. PDGFRs are
expressed in a many cells including fibroblasts,
neurons, endometrial cells, mammary epithelial cells,
and vascular smooth muscle cells. PDGFR signaling is
critical in normal embryonic development, angiogenesis,
and wound healing. PDGFRs transduce mitogenic signals
for connective tissue cells and are important for cell
shape and motility. Kit is important in the development
of melanocytes, germ cells, mast cells, hematopoietic
stem cells, the interstitial cells of Cajal, and the
pacemaker cells of the GI tract. CSF-1R signaling is
critical in the regulation of macrophages and
osteoclasts. Mammalian FLT3 plays an important role in
the survival, proliferation, and differentiation of stem
cells.
Length = 302
Score = 27.1 bits (60), Expect = 0.57
Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 3/38 (7%)
Query: 19 HACKDLHLVLKIMQECWYPVATARPTALRIKKTIASII 56
HA +++ IM+ CW RPT +I + I +
Sbjct: 268 HAPAEIY---DIMKTCWDADPLKRPTFKQIVQLIGKQL 302
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine
Kinase, C-ros. Protein Tyrosine Kinases (PTK) family;
C-ros and Drosophila Sevenless proteins; catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. The
proto-oncogene c-ros encodes an orphan receptor tyr
kinase (RTK) with an unknown ligand. RTKs contain an
extracellular ligand-binding domain, a transmembrane
region, and an intracellular tyr kinase domain. RTKs are
usually activated through ligand binding, which causes
dimerization and autophosphorylation of the
intracellular tyr kinase catalytic domain. C-ros is
expressed in embryonic cells of the kidney, intestine
and lung, but disappears soon after birth. It persists
only in the adult epididymis. Male mice bearing inactive
mutations of c-ros lack the initial segment of the
epididymis and are infertile. The Drosophila protein,
Sevenless, is required for the specification of the R7
photoreceptor cell during eye development.
Length = 269
Score = 26.4 bits (58), Expect = 0.98
Identities = 8/23 (34%), Positives = 13/23 (56%)
Query: 30 IMQECWYPVATARPTALRIKKTI 52
+M CW + RPT RI++ +
Sbjct: 245 LMTNCWAQDPSERPTFDRIQEIL 267
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine
Kinases, Anaplastic Lymphoma Kinase and Leukocyte
Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family;
Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine
(tyr) Kinase (LTK); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to tyr
residues in protein substrates. ALK and LTK are orphan
receptor tyr kinases (RTKs) whose ligands are not yet
well-defined. RTKs contain an extracellular
ligand-binding domain, a transmembrane region, and an
intracellular tyr kinase domain. They are usually
activated through ligand binding, which causes
dimerization and autophosphorylation of the
intracellular tyr kinase catalytic domain. ALK appears
to play an important role in mammalian neural
development as well as visceral muscle differentiation
in Drosophila. ALK is aberrantly expressed as fusion
proteins, due to chromosomal translocations, in about
60% of anaplastic large cell lymphomas (ALCLs). ALK
fusion proteins are also found in rare cases of diffuse
large B cell lymphomas (DLBCLs). LTK is mainly expressed
in B lymphocytes and neuronal tissues. It is important
in cell proliferation and survival. Transgenic mice
expressing TLK display retarded growth and high
mortality rate. In addition, a polymorphism in mouse and
human LTK is implicated in the pathogenesis of systemic
lupus erythematosus.
Length = 277
Score = 25.9 bits (57), Expect = 1.5
Identities = 7/18 (38%), Positives = 9/18 (50%)
Query: 27 VLKIMQECWYPVATARPT 44
V +IM +CW RP
Sbjct: 250 VYRIMTDCWQHTPEDRPN 267
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like
Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK)
family; Human Fyn-related kinase (Frk) and similar
proteins; catalytic (c) domain. The PTKc family is part
of a larger superfamily that includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Frk and
Srk are members of the Src subfamily of proteins, which
are cytoplasmic (or non-receptor) tyr kinases. Src
kinases contain an N-terminal SH4 domain with a
myristoylation site, followed by SH3 and SH2 domains, a
tyr kinase domain, and a regulatory C-terminal region
containing a conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival, and
differentiation. Frk, also known as Rak, is specifically
expressed in liver, lung, kidney, intestine, mammary
glands, and the islets of Langerhans. Rodent homologs
were previously referred to as GTK (gastrointestinal tyr
kinase), BSK (beta-cell Src-like kinase), or IYK
(intestinal tyr kinase). Studies in mice reveal that Frk
is not essential for viability. It plays a role in the
signaling that leads to cytokine-induced beta-cell death
in Type I diabetes. It also regulates beta-cell number
during embryogenesis and early in life.
Length = 261
Score = 25.8 bits (57), Expect = 1.6
Identities = 7/16 (43%), Positives = 8/16 (50%)
Query: 29 KIMQECWYPVATARPT 44
IM +CW RPT
Sbjct: 235 DIMLDCWKEDPDDRPT 250
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine
Kinase, Platelet Derived Growth Factor Receptor alpha.
Protein Tyrosine Kinase (PTK) family; Platelet Derived
Growth Factor Receptor (PDGFR) alpha; catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. PDGFR
alpha is a receptor tyr kinase (RTK) containing an
extracellular ligand-binding region with five
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. The binding to
its ligands, the PDGFs, leads to receptor dimerization,
trans phosphorylation and activation, and intracellular
signaling. PDGFR alpha forms homodimers or heterodimers
with PDGFR beta, depending on the nature of the PDGF
ligand. PDGF-AA, PDGF-AB, and PDGF-CC induce PDGFR alpha
homodimerization. PDGFR signaling plays many roles in
normal embryonic development and adult physiology. PDGFR
alpha signaling is important in the formation of lung
alveoli, intestinal villi, mesenchymal dermis, and hair
follicles, as well as in the development of
oligodendrocytes, retinal astrocytes, neural crest
cells, and testicular cells. Aberrant PDGFR alpha
expression is associated with some human cancers.
Mutations in PDGFR alpha have been found within a subset
of gastrointestinal stromal tumors (GISTs). An active
fusion protein FIP1L1-PDGFR alpha, derived from
interstitial deletion, is associated with idiopathic
hypereosinophilic syndrome (HES) and chronic
eosinophilic leukemia (CEL).
Length = 400
Score = 26.1 bits (57), Expect = 1.6
Identities = 9/32 (28%), Positives = 15/32 (46%)
Query: 25 HLVLKIMQECWYPVATARPTALRIKKTIASII 56
V IM +CW RP+ L + + S++
Sbjct: 367 QEVYDIMVKCWNSEPEKRPSFLHLSDIVESLL 398
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine
Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine
Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4);
pseudokinase domain. The PTKc (catalytic domain) family,
to which this subfamily belongs, includes the catalytic
domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. CCK4,
also called protein tyrosine kinase 7 (PTK7), is an
orphan receptor tyr kinase (RTK) containing an
extracellular region with seven immunoglobulin domains,
a transmembrane segment, and an intracellular inactive
pseudokinase domain. Studies in mice reveal that CCK4 is
essential for neural development. Mouse embryos
containing a truncated CCK4 die perinatally and display
craniorachischisis, a severe form of neural tube defect.
The mechanism of action of the CCK4 pseudokinase is
still unknown. Other pseudokinases such as HER3 rely on
the activity of partner RTKs.
Length = 275
Score = 25.9 bits (57), Expect = 1.8
Identities = 6/16 (37%), Positives = 8/16 (50%)
Query: 29 KIMQECWYPVATARPT 44
K+M CW RP+
Sbjct: 250 KLMTRCWAVNPKDRPS 265
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
Phosphotransferases. Tyrosine-specific kinase subfamily.
Length = 257
Score = 25.6 bits (57), Expect = 2.0
Identities = 6/26 (23%), Positives = 12/26 (46%)
Query: 27 VLKIMQECWYPVATARPTALRIKKTI 52
+ +M +CW RPT + + +
Sbjct: 232 LYDLMLQCWAEDPEDRPTFSELVEIL 257
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
Protein Tyrosine Kinase (PTK) family, catalytic domain.
This PTKc family is part of a larger superfamily that
includes the catalytic domains of protein
serine/threonine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase (PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. They can be classified
into receptor and non-receptor tyr kinases. PTKs play
important roles in many cellular processes including,
lymphocyte activation, epithelium growth and
maintenance, metabolism control, organogenesis
regulation, survival, proliferation, differentiation,
migration, adhesion, motility, and morphogenesis.
Receptor tyr kinases (RTKs) are integral membrane
proteins which contain an extracellular ligand-binding
region, a transmembrane segment, and an intracellular
tyr kinase domain. RTKs are usually activated through
ligand binding, which causes dimerization and
autophosphorylation of the intracellular tyr kinase
catalytic domain, leading to intracellular signaling.
Some RTKs are orphan receptors with no known ligands.
Non-receptor (or cytoplasmic) tyr kinases are
distributed in different intracellular compartments and
are usually multi-domain proteins containing a catalytic
tyr kinase domain as well as various regulatory domains
such as SH3 and SH2. PTKs are usually autoinhibited and
require a mechanism for activation. In many PTKs, the
phosphorylation of tyr residues in the activation loop
is essential for optimal activity. Aberrant expression
of PTKs is associated with many development
abnormalities and cancers.
Length = 262
Score = 25.6 bits (57), Expect = 2.2
Identities = 6/22 (27%), Positives = 10/22 (45%)
Query: 29 KIMQECWYPVATARPTALRIKK 50
++M CW RPT + +
Sbjct: 238 ELMLSCWQLDPEDRPTFSELVE 259
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like
Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK)
family; Insulin Receptor (InsR) subfamily; catalytic (c)
domain. The PTKc family is part of a larger superfamily
that includes the catalytic domains of other kinases
such as protein serine/threonine kinases, RIO kinases,
and phosphoinositide 3-kinase (PI3K). The InsR subfamily
is composed of InsR, Insulin-like Growth Factor-1
Receptor (IGF-1R), and similar proteins. PTKs catalyze
the transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. InsR and
IGF-1R are receptor tyr kinases (RTKs) composed of two
alphabeta heterodimers. Binding of the ligand (insulin,
IGF-1, or IGF-2) to the extracellular alpha subunit
activates the intracellular tyr kinase domain of the
transmembrane beta subunit. Receptor activation leads to
autophosphorylation, stimulating downstream kinase
activities, which initiate signaling cascades and
biological function. InsR and IGF-1R, which share 84%
sequence identity in their kinase domains, display
physiologically distinct yet overlapping functions in
cell growth, differentiation, and metabolism. InsR
activation leads primarily to metabolic effects while
IGF-1R activation stimulates mitogenic pathways. In
cells expressing both receptors, InsR/IGF-1R hybrids are
found together with classical receptors. Both receptors
can interact with common adaptor molecules such as IRS-1
and IRS-2.
Length = 277
Score = 25.4 bits (56), Expect = 2.3
Identities = 9/22 (40%), Positives = 13/22 (59%)
Query: 27 VLKIMQECWYPVATARPTALRI 48
+L++M+ CW RPT L I
Sbjct: 250 LLELMRMCWQYNPKMRPTFLEI 271
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
Phosphotransferases. The specificity of this class of
kinases can not be predicted. Possible dual-specificity
Ser/Thr/Tyr kinase.
Length = 258
Score = 25.2 bits (56), Expect = 2.5
Identities = 7/26 (26%), Positives = 13/26 (50%)
Query: 27 VLKIMQECWYPVATARPTALRIKKTI 52
+ K+M +CW RPT + + +
Sbjct: 233 LYKLMLQCWAEDPEDRPTFSELVEIL 258
>gnl|CDD|224183 COG1263, PtsG, Phosphotransferase system IIC components,
glucose/maltose/N-acetylglucosamine-specific
[Carbohydrate transport and metabolism].
Length = 393
Score = 25.3 bits (56), Expect = 2.6
Identities = 6/26 (23%), Positives = 11/26 (42%)
Query: 9 QIRPAIPNRWHACKDLHLVLKIMQEC 34
+ P + NR++ K +LK
Sbjct: 132 TVIPILYNRFYLIKIEPELLKFFPGK 157
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine
Kinase, Colony-Stimulating Factor-1 Receptor. Protein
Tyrosine Kinase (PTK) family; Colony-Stimulating
Factor-1 Receptor (CSF-1R); catalytic (c) domain. The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. CSF-1R,
also called c-Fms, is a member of the Platelet Derived
Growth Factor Receptor (PDGFR) subfamily of proteins,
which are receptor tyr kinases (RTKs) containing an
extracellular ligand-binding region with five
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. The binding of
CSF-1R to its ligand, CSF-1, leads to receptor
dimerization, trans phosphorylation and activation, and
intracellular signaling. CSF-1R signaling is critical in
the regulation of macrophages and osteoclasts. It leads
to increases in gene transcription and protein
translation, and induces cytoskeletal remodeling. CSF-1R
signaling leads to a variety of cellular responses
including survival, proliferation, and differentiation
of target cells. It plays an important role in innate
immunity, tissue development and function, and the
pathogenesis of some diseases including atherosclerosis
and cancer. CSF-1R signaling is also implicated in
mammary gland development during pregnancy and
lactation. Aberrant CSF-1/CSF-1R expression correlates
with tumor cell invasiveness, poor clinical prognosis,
and bone metastasis in breast cancer. Although the
structure of the human CSF-1R catalytic domain is known,
it is excluded from this specific alignment model
because it contains a deletion in its sequence.
Length = 374
Score = 25.2 bits (55), Expect = 2.7
Identities = 10/23 (43%), Positives = 13/23 (56%)
Query: 30 IMQECWYPVATARPTALRIKKTI 52
IM+ CW T RPT +I + I
Sbjct: 347 IMKMCWNLEPTERPTFSQISQLI 369
>gnl|CDD|236407 PRK09198, PRK09198, putative nicotinate phosphoribosyltransferase;
Provisional.
Length = 463
Score = 25.2 bits (56), Expect = 2.7
Identities = 8/25 (32%), Positives = 13/25 (52%), Gaps = 5/25 (20%)
Query: 30 IMQECWYP--VATARPTALRIKKTI 52
+++ WYP VAT + K+ I
Sbjct: 136 LLRNVWYPSTVAT---ISWEYKQLI 157
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine
Kinases, Bruton's tyrosine kinase and Bone marrow kinase
on the X chromosome. Protein Tyrosine Kinase (PTK)
family; Bruton's tyrosine kinase (Btk) and Bone marrow
kinase on the X chromosome (Bmx); catalytic (c) domain.
The PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Btk and
Bmx (also named Etk) are members of the Tec subfamily of
proteins, which are cytoplasmic (or nonreceptor) tyr
kinases with similarity to Src kinases in that they
contain Src homology protein interaction domains (SH3,
SH2) N-terminal to the catalytic tyr kinase domain.
Unlike Src kinases, most Tec subfamily members (except
Rlk) also contain an N-terminal pleckstrin homology (PH)
domain, which binds the products of PI3K and allows
membrane recruitment and activation. In addition, Btk
contains the Tec homology (TH) domain with proline-rich
and zinc-binding regions. Tec kinases are expressed
mainly by haematopoietic cells. Btk is expressed in
B-cells, and a variety of myeloid cells including mast
cells, platelets, neutrophils, and dendrictic cells. It
interacts with a variety of partners, from cytosolic
proteins to nuclear transcription factors, suggesting a
diversity of functions. Stimulation of a diverse array
of cell surface receptors, including antigen engagement
of the B-cell receptor (BCR), leads to PH-mediated
membrane translocation of Btk and subsequent
phosphorylation by Src kinase and activation. Btk plays
an important role in the life cycle of B-cells including
their development, differentiation, proliferation,
survival, and apoptosis. Mutations in Btk cause the
primary immunodeficiency disease, X-linked
agammaglobulinaemia (XLA) in humans. Bmx is primarily
expressed in bone marrow and the arterial endothelium,
and plays an important role in ischemia-induced
angiogenesis. It facilitates arterial growth, capillary
formation, vessel maturation, and bone marrow-derived
endothelial progenitor cell mobilization.
Length = 256
Score = 25.2 bits (55), Expect = 3.1
Identities = 9/18 (50%), Positives = 10/18 (55%)
Query: 27 VLKIMQECWYPVATARPT 44
V IM CW+ A RPT
Sbjct: 230 VYAIMYSCWHEKAEERPT 247
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine
Kinases, Tyrosine kinase expressed in hepatocellular
carcinoma and Resting lymphocyte kinase. Protein
Tyrosine Kinase (PTK) family; Tyrosine kinase expressed
in hepatocellular carcinoma (Tec) and Resting lymphocyte
kinase (Rlk); catalytic (c) domain. The PTKc family is
part of a larger superfamily, that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Tec and
Rlk (also named Txk) are members of the Tec subfamily of
proteins, which are cytoplasmic (or nonreceptor) tyr
kinases with similarity to Src kinases in that they
contain Src homology protein interaction domains (SH3,
SH2) N-terminal to the catalytic tyr kinase domain.
Unlike Src kinases, most Tec subfamily members (except
Rlk) also contain an N-terminal pleckstrin homology (PH)
domain, which binds the products of PI3K and allows
membrane recruitment and activation. Instead of PH, Rlk
contains an N-terminal cysteine-rich region. In addition
to PH, Tec also contains the Tec homology (TH) domain
with proline-rich and zinc-binding regions. Tec kinases
are expressed mainly by haematopoietic cells. Tec is
more widely-expressed than other Tec subfamily kinases.
It is found in endothelial cells, both B- and T-cells,
and a variety of myeloid cells including mast cells,
erythroid cells, platelets, macrophages and neutrophils.
Rlk is expressed in T-cells and mast cell lines. Tec and
Rlk are both key components of T-cell receptor (TCR)
signaling. They are important in TCR-stimulated
proliferation, IL-2 production and phopholipase C-gamma1
activation.
Length = 256
Score = 25.2 bits (55), Expect = 3.1
Identities = 8/28 (28%), Positives = 13/28 (46%)
Query: 25 HLVLKIMQECWYPVATARPTALRIKKTI 52
V ++M CW+ RPT + + I
Sbjct: 228 MTVYEVMYSCWHEKPEGRPTFAELLRAI 255
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein
Tyrosine Kinases, Janus kinases. Protein Tyrosine
Kinase (PTK) family; Janus kinase (Jak) subfamily;
catalytic (c) domain (repeat 2). The Jak subfamily is
composed of Jak1, Jak2, Jak3, TYK2, and similar
proteins. The PTKc family is part of a larger
superfamily that includes the catalytic domains of other
kinases such as protein serine/threonine kinases, RIO
kinases, and phosphoinositide 3-kinase (PI3K). PTKs
catalyze the transfer of the gamma-phosphoryl group from
ATP to tyrosine (tyr) residues in protein substrates.
Jak subfamily proteins are cytoplasmic (or nonreceptor)
tyr kinases containing an N-terminal FERM domain,
followed by a Src homology 2 (SH2) domain, a
pseudokinase domain, and a C-terminal tyr kinase
catalytic domain. Most Jaks are expressed in a wide
variety of tissues, except for Jak3, which is expressed
only in hematopoietic cells. Jaks are crucial for
cytokine receptor signaling. They are activated by
autophosphorylation upon cytokine-induced receptor
aggregation, and subsequently trigger downstream
signaling events such as the phosphorylation of signal
transducers and activators of transcription (STATs).
Jaks are also involved in regulating the surface
expression of some cytokine receptors. The Jak-STAT
pathway is involved in many biological processes
including hematopoiesis, immunoregulation, host defense,
fertility, lactation, growth, and embryogenesis.
Length = 284
Score = 25.1 bits (55), Expect = 3.3
Identities = 6/18 (33%), Positives = 9/18 (50%)
Query: 27 VLKIMQECWYPVATARPT 44
V +M+ CW RP+
Sbjct: 255 VYDLMKLCWEAEPQDRPS 272
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain.
Length = 260
Score = 24.9 bits (55), Expect = 3.4
Identities = 7/50 (14%), Positives = 17/50 (34%)
Query: 1 MRKVVCLDQIRPAIPNRWHACKDLHLVLKIMQECWYPVATARPTALRIKK 50
+++ P + ++++C + RPTA I +
Sbjct: 207 QLQLIRRILGPPLEFDEPKWSSGSEEAKDLIKKCLNKDPSKRPTAEEILQ 256
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 2. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 2 (FGFR2); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR2 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. There are many splice
variants of FGFR2 which show differential expression and
binding to FGF ligands. Disruption of either FGFR2 or
FGFR2b is lethal in mice, due to defects in the placenta
or severe impairment of tissue development including
lung, limb, and thyroid, respectively. Disruption of
FGFR2c in mice results in defective bone and skull
development. Genetic alterations of FGFR2 are associated
with many human skeletal disorders including Apert
syndrome, Crouzon syndrome, Jackson-Weiss syndrome, and
Pfeiffer syndrome.
Length = 304
Score = 24.6 bits (53), Expect = 4.2
Identities = 6/15 (40%), Positives = 12/15 (80%)
Query: 30 IMQECWYPVATARPT 44
+M++CW+ + + RPT
Sbjct: 271 MMRDCWHAIPSHRPT 285
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the
Protein Tyrosine Kinases, Janus kinases 2 and 3.
Protein Tyrosine Kinase (PTK) family; Janus kinase 2
(Jak2) and Jak3; catalytic (c) domain (repeat 2). The
PTKc family is part of a larger superfamily that
includes the catalytic domains of other kinases such as
protein serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Jak2 and
Jak3 are members of the Janus kinase (Jak) subfamily of
proteins, which are cytoplasmic (or nonreceptor) tyr
kinases containing an N-terminal FERM domain, followed
by a Src homology 2 (SH2) domain, a pseudokinase domain,
and a C-terminal catalytic tyr kinase domain. Jaks are
crucial for cytokine receptor signaling. They are
activated by autophosphorylation upon cytokine-induced
receptor aggregation, and subsequently trigger
downstream signaling events such as the phosphorylation
of signal transducers and activators of transcription
(STATs). Jak2 is widely expressed in many tissues while
Jak3 is expressed only in hematopoietic cells. Jak2 is
essential for the signaling of hormone-like cytokines
such as growth hormone, erythropoietin, thrombopoietin,
and prolactin, as well as some IFNs and cytokines that
signal through the IL-3 and gp130 receptors. Jak3 binds
the shared receptor subunit common gamma chain and thus,
is essential in the signaling of cytokines that use it
such as IL-2, IL-4, IL-7, IL-9, IL-15, and IL-21.
Disruption of Jak2 in mice results in an embryonic
lethal phenotype with multiple defects including
erythropoietic and cardiac abnormalities. It is the only
Jak gene that results in a lethal phenotype when
disrupted in mice. A mutation in the pseudokinase domain
of Jak2, V617F, is present in many myeloproliferative
diseases, including almost all patients with
polycythemia vera, and 50% of patients with essential
thrombocytosis and myelofibrosis. Jak3 is important in
lymphoid development and myeloid cell differentiation.
Inactivating mutations in Jak3 have been reported in
humans with severe combined immunodeficiency (SCID).
Length = 284
Score = 24.7 bits (54), Expect = 4.3
Identities = 7/18 (38%), Positives = 11/18 (61%)
Query: 27 VLKIMQECWYPVATARPT 44
+ IM+ECW + RP+
Sbjct: 255 IYAIMKECWNNDPSQRPS 272
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src
kinase-like Protein Tyrosine Kinases. Protein Tyrosine
Kinase (PTK) family; C-terminal Src kinase (Csk)
subfamily; catalytic (c) domain. The Csk subfamily is
composed of Csk, Chk, and similar proteins. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Csk
subfamily kinases are cytoplasmic (or nonreceptor) tyr
kinases containing the Src homology domains, SH3 and
SH2, N-terminal to the catalytic tyr kinase domain. They
negatively regulate the activity of Src kinases that are
anchored to the plasma membrane. To inhibit Src kinases,
Csk and Chk are translocated to the membrane via binding
to specific transmembrane proteins, G-proteins, or
adaptor proteins near the membrane. Csk catalyzes the
tyr phosphorylation of the regulatory C-terminal tail of
Src kinases, resulting in their inactivation. Chk
inhibit Src kinases using a noncatalytic mechanism by
simply binding to them. As negative regulators of Src
kinases, Csk and Chk play important roles in cell
proliferation, survival, and differentiation, and
consequently, in cancer development and progression.
Length = 256
Score = 24.7 bits (54), Expect = 4.7
Identities = 10/29 (34%), Positives = 18/29 (62%)
Query: 27 VLKIMQECWYPVATARPTALRIKKTIASI 55
V K+M++CW RPT ++++ +A I
Sbjct: 228 VYKVMKDCWELDPAKRPTFKQLREQLALI 256
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine
Kinase, Fibroblast Growth Factor Receptor 1. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor 1 (FGFR1); catalytic (c) domain. The PTKc
family is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. FGFR1 is
part of the FGFR subfamily, which are receptor tyr
kinases (RTKs) containing an extracellular
ligand-binding region with three immunoglobulin-like
domains, a transmembrane segment, and an intracellular
catalytic domain. The binding of FGFRs to their ligands,
the FGFs, results in receptor dimerization and
activation, and intracellular signaling. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. Alternative splicing of
FGFR1 transcripts produces a variety of isoforms, which
are differentially expressed in cells. FGFR1 binds the
ligands, FGF1 and FGF2, with high affinity and has also
been reported to bind FGF4, FGF6, and FGF9. FGFR1
signaling is critical in the control of cell migration
during embryo development. It promotes cell
proliferation in fibroblasts. Nuclear FGFR1 plays a role
in the regulation of transcription. Mutations,
insertions or deletions of FGFR1 have been identified in
patients with Kallman's syndrome (KS), an inherited
disorder characterized by hypogonadotropic hypogonadism
and loss of olfaction. Aberrant FGFR1 expression has
been found in some human cancers including 8P11
myeloproliferative syndrome (EMS), breast cancer, and
pancreatic adenocarcinoma.
Length = 307
Score = 24.6 bits (53), Expect = 4.9
Identities = 7/20 (35%), Positives = 14/20 (70%)
Query: 25 HLVLKIMQECWYPVATARPT 44
+ + +M++CW+ V + RPT
Sbjct: 269 NELYMMMRDCWHAVPSQRPT 288
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase,
Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase;
catalytic (c) domain. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Fer kinase is a member
of the Fes subfamily of proteins which are cytoplasmic
(or nonreceptor) tyr kinases containing an N-terminal
region with FCH (Fes/Fer/CIP4 homology) and coiled-coil
domains, followed by a SH2 domain, and a C-terminal
catalytic domain. Fer kinase is expressed in a wide
variety of tissues, and is found to reside in both the
cytoplasm and the nucleus. It plays important roles in
neuronal polarization and neurite development,
cytoskeletal reorganization, cell migration, growth
factor signaling, and the regulation of cell-cell
interactions mediated by adherens junctions and focal
adhesions. Fer kinase also regulates cell cycle
progression in malignant cells.
Length = 250
Score = 24.6 bits (53), Expect = 4.9
Identities = 10/28 (35%), Positives = 15/28 (53%)
Query: 27 VLKIMQECWYPVATARPTALRIKKTIAS 54
V K+MQ CW RP ++K +A+
Sbjct: 223 VYKVMQRCWDYKPENRPKFSELQKELAA 250
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein
Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine
Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic
(c) domain (repeat 2). The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K). PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. Tyk2 is a member of the
Janus kinase (Jak) subfamily of proteins, which are
cytoplasmic (or nonreceptor) tyr kinases containing an
N-terminal FERM domain, followed by a Src homology 2
(SH2) domain, a pseudokinase domain, and a C-terminal
tyr kinase catalytic domain. Jaks are crucial for
cytokine receptor signaling. They are activated by
autophosphorylation upon cytokine-induced receptor
aggregation, and subsequently trigger downstream
signaling events such as the phosphorylation of signal
transducers and activators of transcription (STATs).
Tyk2 is widely expressed in many tissues. It is involved
in signaling via the cytokine receptors IFN-alphabeta,
IL-6, IL-10, IL-12, IL-13, and IL-23. It mediates cell
surface urokinase receptor (uPAR) signaling and plays a
role in modulating vascular smooth muscle cell (VSMC)
functional behavior in response to injury. Tyk2 is also
important in dendritic cell function and T helper (Th)1
cell differentiation. A homozygous mutation of Tyk2 was
found in a patient with hyper-IgE syndrome (HIES), a
primary immunodeficiency characterized by recurrent skin
abscesses, pneumonia, and elevated serum IgE. This
suggests that Tyk2 may play important roles in multiple
cytokine signaling involved in innate and adaptive
immunity.
Length = 283
Score = 24.5 bits (53), Expect = 5.0
Identities = 8/18 (44%), Positives = 10/18 (55%)
Query: 27 VLKIMQECWYPVATARPT 44
V +M+ CW A RPT
Sbjct: 253 VYILMKNCWETEAKFRPT 270
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase.
Length = 258
Score = 24.4 bits (54), Expect = 5.5
Identities = 9/34 (26%), Positives = 15/34 (44%), Gaps = 5/34 (14%)
Query: 11 RPAIPNRWHACKDLHLVLKIMQECWYPVATARPT 44
R P + +L+ ++M +CW RPT
Sbjct: 222 RLPRPE--NCPDELY---ELMLQCWAYDPEDRPT 250
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine
Kinases, Fibroblast Growth Factor Receptors. Protein
Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
Receptor (FGFR) subfamily; catalytic (c) domain. The
FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4,
and similar proteins. The PTKc family is part of a
larger superfamily that includes the catalytic domains
of other kinases such as protein serine/threonine
kinases, RIO kinases, and phosphoinositide 3-kinase
(PI3K).PTKs catalyze the transfer of the
gamma-phosphoryl group from ATP to tyrosine (tyr)
residues in protein substrates. FGFR subfamily members
are receptor tyr kinases (RTKs) containing an
extracellular ligand-binding region with three
immunoglobulin-like domains, a transmembrane segment,
and an intracellular catalytic domain. The binding of
FGFRs to their ligands, the FGFs, and to heparin/heparan
sulfate (HS) results in the formation of a ternary
complex, which leads to receptor dimerization and
activation, and intracellular signaling. There are at
least 23 FGFs and four types of FGFRs. The binding of
FGFs to FGFRs is promiscuous, in that a receptor may be
activated by several ligands and a ligand may bind to
more that one type of receptor. FGF/FGFR signaling is
important in the regulation of embryonic development,
homeostasis, and regenerative processes. Depending on
the cell type and stage, FGFR signaling produces diverse
cellular responses including proliferation, growth
arrest, differentiation, and apoptosis. Aberrant
signaling leads to many human diseases such as skeletal,
olfactory, and metabolic disorders, as well as cancer.
Length = 293
Score = 23.9 bits (52), Expect = 8.5
Identities = 7/15 (46%), Positives = 12/15 (80%)
Query: 30 IMQECWYPVATARPT 44
+M++CW+ V + RPT
Sbjct: 266 LMRDCWHEVPSQRPT 280
>gnl|CDD|221522 pfam12309, KBP_C, KIF-1 binding protein C terminal. This family of
proteins is found in bacteria and eukaryotes. Proteins
in this family are typically between 365 and 621 amino
acids in length. There is a conserved LLP sequence
motif. KBP is a binding partner for KIF1Balpha that is a
regulator of its transport function and thus represents
a type of kinesin interacting protein.
Length = 365
Score = 23.9 bits (52), Expect = 9.5
Identities = 4/33 (12%), Positives = 13/33 (39%)
Query: 28 LKIMQECWYPVATARPTALRIKKTIASIILSDQ 60
L + ++ + + A L +K + ++
Sbjct: 213 LTLCRQLLFELGEAYSEMLDLKVAQLDLPQDEK 245
>gnl|CDD|237915 PRK15123, PRK15123, lipopolysaccharide core heptose(I) kinase RfaP;
Provisional.
Length = 268
Score = 23.8 bits (52), Expect = 9.7
Identities = 9/16 (56%), Positives = 10/16 (62%), Gaps = 1/16 (6%)
Query: 9 QIRPAIPNRWHACKDL 24
QIR +P RW KDL
Sbjct: 193 QIRARVPRRWRD-KDL 207
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.327 0.136 0.439
Gapped
Lambda K H
0.267 0.0807 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,384,836
Number of extensions: 234377
Number of successful extensions: 241
Number of sequences better than 10.0: 1
Number of HSP's gapped: 241
Number of HSP's successfully gapped: 31
Length of query: 69
Length of database: 10,937,602
Length adjustment: 39
Effective length of query: 30
Effective length of database: 9,207,796
Effective search space: 276233880
Effective search space used: 276233880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (24.0 bits)