BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10031
         (218 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1EX1|A Chain A, Beta-D-Glucan Exohydrolase From Barley
 pdb|1IEX|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
           Isoenzyme Exo1 In Complex With
           4i,4iii,4v-S-Trithiocellohexaose
 pdb|1IEW|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
           Isoenzyme Exo1 In Complex With
           2-Deoxy-2-Fluoro-Alpha-D-Glucoside
 pdb|1IEV|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
           Isoenzyme Exo1 In Complex With Cyclohexitol
 pdb|1IEQ|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
           Isoenzyme Exo1
 pdb|1J8V|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
           Isoenzyme Exo1 In Complex With 4'-Nitrophenyl
           3i-Thiolaminaritrioside
          Length = 605

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%)

Query: 53  SEGPLATLPKGGPPIHIAQEKADQIGYMPLRDDFEWQYDNNAESVVSGLIHLEDTDVDTT 112
           ++ PL  LPK  P I +A   AD +GY       EWQ D    +V + ++      VD +
Sbjct: 399 TDAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPS 458

Query: 113 LKLVHVD 119
             +V  +
Sbjct: 459 TVVVFAE 465


>pdb|1LQ2|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
           Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
 pdb|1X38|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
           Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
 pdb|1X39|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
           Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
          Length = 602

 Score = 36.6 bits (83), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%)

Query: 53  SEGPLATLPKGGPPIHIAQEKADQIGYMPLRDDFEWQYDNNAESVVSGLIHLEDTDVDTT 112
           ++ PL  LPK  P I +A   AD +GY       EWQ D    +V + ++      VD +
Sbjct: 399 TDAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPS 458

Query: 113 LKLVHVD 119
             +V  +
Sbjct: 459 TVVVFAE 465


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.136    0.395 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,853,240
Number of Sequences: 62578
Number of extensions: 237489
Number of successful extensions: 554
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 550
Number of HSP's gapped (non-prelim): 6
length of query: 218
length of database: 14,973,337
effective HSP length: 95
effective length of query: 123
effective length of database: 9,028,427
effective search space: 1110496521
effective search space used: 1110496521
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)