BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10031
(218 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1EX1|A Chain A, Beta-D-Glucan Exohydrolase From Barley
pdb|1IEX|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
Isoenzyme Exo1 In Complex With
4i,4iii,4v-S-Trithiocellohexaose
pdb|1IEW|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
Isoenzyme Exo1 In Complex With
2-Deoxy-2-Fluoro-Alpha-D-Glucoside
pdb|1IEV|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
Isoenzyme Exo1 In Complex With Cyclohexitol
pdb|1IEQ|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
Isoenzyme Exo1
pdb|1J8V|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
Isoenzyme Exo1 In Complex With 4'-Nitrophenyl
3i-Thiolaminaritrioside
Length = 605
Score = 37.0 bits (84), Expect = 0.009, Method: Compositional matrix adjust.
Identities = 20/67 (29%), Positives = 31/67 (46%)
Query: 53 SEGPLATLPKGGPPIHIAQEKADQIGYMPLRDDFEWQYDNNAESVVSGLIHLEDTDVDTT 112
++ PL LPK P I +A AD +GY EWQ D +V + ++ VD +
Sbjct: 399 TDAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPS 458
Query: 113 LKLVHVD 119
+V +
Sbjct: 459 TVVVFAE 465
>pdb|1LQ2|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
pdb|1X38|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
pdb|1X39|A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase
Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
Length = 602
Score = 36.6 bits (83), Expect = 0.010, Method: Compositional matrix adjust.
Identities = 20/67 (29%), Positives = 31/67 (46%)
Query: 53 SEGPLATLPKGGPPIHIAQEKADQIGYMPLRDDFEWQYDNNAESVVSGLIHLEDTDVDTT 112
++ PL LPK P I +A AD +GY EWQ D +V + ++ VD +
Sbjct: 399 TDAPLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPS 458
Query: 113 LKLVHVD 119
+V +
Sbjct: 459 TVVVFAE 465
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.136 0.395
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,853,240
Number of Sequences: 62578
Number of extensions: 237489
Number of successful extensions: 554
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 550
Number of HSP's gapped (non-prelim): 6
length of query: 218
length of database: 14,973,337
effective HSP length: 95
effective length of query: 123
effective length of database: 9,028,427
effective search space: 1110496521
effective search space used: 1110496521
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)