BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10036
         (366 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CDD|A Chain A, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
           From Shewanella Oneidensis
 pdb|3CDD|B Chain B, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
           From Shewanella Oneidensis
 pdb|3CDD|C Chain C, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
           From Shewanella Oneidensis
 pdb|3CDD|D Chain D, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
           From Shewanella Oneidensis
 pdb|3CDD|E Chain E, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
           From Shewanella Oneidensis
 pdb|3CDD|F Chain F, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
           From Shewanella Oneidensis
          Length = 361

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 40  FHGVRYMDGGVSDNLPVLDENTITVSPFCGESDICPRDLSPQLFHMNFANTSVELSSQNF 99
             G R + G V D +P  DE+TIT+S       +  RD +  L   +    S + ++Q  
Sbjct: 67  IGGERVITGYVDDWVPSYDESTITIS-------VSGRDKTADLVDCSIDYPSGQFNNQTL 119

Query: 100 FRIMRILFPP 109
            +I  I+  P
Sbjct: 120 TQIADIVCKP 129


>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase
 pdb|2VZ8|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase
 pdb|2VZ9|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase In
            Complex With Nadp
 pdb|2VZ9|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase In
            Complex With Nadp
          Length = 2512

 Score = 28.1 bits (61), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 7/75 (9%)

Query: 19   LRQALLASAFVPFFSGFIPPKFHGVRYMDGGVSDNLPVLDENTITVSPFCGESDICPRDL 78
            LR A+L +    FF     PK+ G   +D    +  P LD   I  S  CG  +    + 
Sbjct: 1975 LRDAVLENQTPEFFQDVSKPKYSGTANLDRVTREACPELDYFVIFSSVSCGRGNAGQAN- 2033

Query: 79   SPQLFHMNFANTSVE 93
                    FAN+++E
Sbjct: 2034 ------YGFANSAME 2042


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.137    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,041,070
Number of Sequences: 62578
Number of extensions: 376817
Number of successful extensions: 724
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 723
Number of HSP's gapped (non-prelim): 4
length of query: 366
length of database: 14,973,337
effective HSP length: 100
effective length of query: 266
effective length of database: 8,715,537
effective search space: 2318332842
effective search space used: 2318332842
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)