BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10036
(366 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3CDD|A Chain A, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
From Shewanella Oneidensis
pdb|3CDD|B Chain B, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
From Shewanella Oneidensis
pdb|3CDD|C Chain C, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
From Shewanella Oneidensis
pdb|3CDD|D Chain D, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
From Shewanella Oneidensis
pdb|3CDD|E Chain E, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
From Shewanella Oneidensis
pdb|3CDD|F Chain F, Crystal Structure Of Prophage Muso2, 43 Kda Tail Protein
From Shewanella Oneidensis
Length = 361
Score = 30.0 bits (66), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 7/70 (10%)
Query: 40 FHGVRYMDGGVSDNLPVLDENTITVSPFCGESDICPRDLSPQLFHMNFANTSVELSSQNF 99
G R + G V D +P DE+TIT+S + RD + L + S + ++Q
Sbjct: 67 IGGERVITGYVDDWVPSYDESTITIS-------VSGRDKTADLVDCSIDYPSGQFNNQTL 119
Query: 100 FRIMRILFPP 109
+I I+ P
Sbjct: 120 TQIADIVCKP 129
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase
pdb|2VZ8|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase
pdb|2VZ9|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase In
Complex With Nadp
pdb|2VZ9|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase In
Complex With Nadp
Length = 2512
Score = 28.1 bits (61), Expect = 8.8, Method: Compositional matrix adjust.
Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 7/75 (9%)
Query: 19 LRQALLASAFVPFFSGFIPPKFHGVRYMDGGVSDNLPVLDENTITVSPFCGESDICPRDL 78
LR A+L + FF PK+ G +D + P LD I S CG + +
Sbjct: 1975 LRDAVLENQTPEFFQDVSKPKYSGTANLDRVTREACPELDYFVIFSSVSCGRGNAGQAN- 2033
Query: 79 SPQLFHMNFANTSVE 93
FAN+++E
Sbjct: 2034 ------YGFANSAME 2042
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.137 0.416
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,041,070
Number of Sequences: 62578
Number of extensions: 376817
Number of successful extensions: 724
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 723
Number of HSP's gapped (non-prelim): 4
length of query: 366
length of database: 14,973,337
effective HSP length: 100
effective length of query: 266
effective length of database: 8,715,537
effective search space: 2318332842
effective search space used: 2318332842
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)