Diaphorina citri psyllid: psy10043


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MILDSNDSIGVLKERLKKINKVKSRNEELEDEPEVLAAKCKKLAEAIQNAKHVVVYTGAGISTAAKIPDYRSNFTIYRLKKINKVKSRNEELEDKPEILAAKCKQLAEAIQNAKHVVVYTGAGISTAAKIPDYRGTKGIWTLLQQGKDIGNHDLSLAEPTLTHMALYKLYRHGFVKHVVSQNCDDLHLRSGLPRSVLSEVHGNMSVEVCAHCDPVKYYWRVFDVTEHTARYAHQTARKCSCGEPLLDTIIHFGEKGVLLWPLNWDGANKNADRADLILCVGSSLKVLRKYGWLWGLDRPKKERPKLCIVNLQWTPKDDQATLKINGKYPVLRKYGWLWGLDRPKKERPKLCIVNLQWTPKDDQATLKINGKCDVVFKQLMAHLNLDIPAYDKRRDPVFYHSSHLIQPEYHTVRKPMLDLPDEEYFSKYEDCENLLESFREMENYQNSTVFVKDEDGVKDEDGVKDEDGVKEEDGKEEAFDEDKAGGGRESNVRFPPGADFILNG
cccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEcccccHHHHcccccccEEEccccccccccccccccccccHHHHHHHHHHHcccccccccccccCECccEEEEccccccccHHHHHHHHHHHHHccEEEEEccccEEEccccccccccccccccccEEEEccccccccccccEEECccHHHHHHHHHHHccccccccccccCECcccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccc
**********************************VLAAKCKKLAEAIQNAKHVVVYTGAGISTAAKIPDYRSNFTIYRLKKINKV*******EDKPEILAAKCKQLAEAIQNAKHVVVYTGAGISTAAKIPDYRGTKGIWTLLQQGKDIGNHDLSLAEPTLTHMALYKLYRHGFVKHVVSQNCDDLHLRSGLPRSVLSEVHGNMSVEVCAHCDPVKYYWRVFDVTEHTARYAHQTARKCSCGEPLLDTIIHFGEKGVLLWPLNWDGANKNADRADLILCVGSSLKVLRKYGWLWGLDRPKKERPKLCIVNLQWTPKDDQATLKINGKYPVLRKYGWLWGLDRPKKERPKLCIVNLQWTPKDDQATLKINGKCDVVFKQLMAHLNLDIPAYDKRRDPVFYHSSHLIQPEYHTVRKPMLDLPDEEYFSKYEDCENLLESFREMENYQ**TVF****DG*K*********************************VRFPPGADFILNG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILDSNDSIGVxxxxxxxxxxxxxxxxxxxxxPEVLAAKCKKLAEAIQNAKHVVVYTGAGISTAAKIPDYRSNFTIYRLKKINKVKSRNEELEDKPEILAAKCKQLAEAIQNAKHVVVYTGAGISTAAKIPDYRGTKGIWTLLQQGKDIGNHDLSLAEPTLTHMALYKLYRHGFVKHVVSQNCDDLHLRSGLPRSVLSEVHGNMSVEVCAHCDPVKYYWRVFDVTEHTARYAHQTARKCSCGEPLLDTIIHFGEKGVLLWPLNWDGANKNADRADLILCVGSSLKVLRKYGWLWGLDRPKKERPKLCIVNLQWTPKDDQATLKINGKYPVLRKYGWLWGLDRPKKERPKLCIVNLQWTPKDDQATLKINGKCDVVFKQLMAHLNLDIPAYDKRRDPVFYHSSHLIQPEYHTVRKPMLDLPDEEYFSKYEDCENLLESFREMENYQNSTVFVKDEDGVKDEDGVKDEDGVKEEDGKEEAFDEDKAGGGRESNVRFPPGADFILNG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NAD-dependent protein deacetylase sirtuin-7 NAD-dependent protein deacetylase. Required to restore the transcription of ribosomal RNA (rRNA) at the exit from mitosis. Promotes the association of RNA polymerase I with the rDNA promoter region and coding region. Stimulates transcription activity of the RNA polymerase I complex.confidentQ9NRC8
NAD-dependent protein deacetylase sirtuin-7 NAD-dependent protein deacetylase. Required to restore the transcription of ribosomal RNA (rRNA) at the exit from mitosis. Promotes the association of RNA polymerase I with the rDNA promoter region and coding region. Stimulates transcription activity of the RNA polymerase I complex.confidentQ0P595
NAD-dependent protein deacetylase sirtuin-7 NAD-dependent protein deacetylase that specifically mediates deacetylation of histone H3 at 'Lys-18' (H3K18Ac). In contrast to other histone deacetylases, displays selectivity for a single histone mark, H3K18Ac, directly linked to control of gene expression. H3K18Ac is mainly present around the transcription start site of genes and has been linked to activation of nuclear hormone receptors. SIRT7 thereby acts as a transcription repressor. Moreover, H3K18 hypoacetylation has been reported as a marker of malignancy in various cancers and seems to maintain the transformed phenotype of cancer cells. These data suggest that SIRT7 may play a key role in oncogenic transformation by suppresses expression of tumor suppressor genes by locus-specific deacetylation of H3K18Ac at promoter regions. Also required to restore the transcription of ribosomal RNA (rRNA) at the exit from mitosis: promotes the association of RNA polymerase I with the rDNA promoter region and coding region. Stimulates transcription activity of the RNA polymerase I complex. May also deacetylate p53/TP53 and promotes cell survival, however such data need additional confirmation.confidentB2RZ55

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070932 [BP]histone H3 deacetylationprobableGO:0006476, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0016575, GO:0071704, GO:0016570, GO:0035601, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0034645 [BP]cellular macromolecule biosynthetic processprobableGO:1901576, GO:0044260, GO:0071704, GO:0009987, GO:0044237, GO:0043170, GO:0044249, GO:0009058, GO:0009059, GO:0008150, GO:0008152
GO:0097372 [MF]NAD-dependent histone deacetylase activity (H3-K18 specific)probableGO:0016787, GO:0019213, GO:0034739, GO:0004407, GO:0016810, GO:0016811, GO:0017136, GO:0034979, GO:0003824, GO:0003674, GO:0033558
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0005731 [CC]nucleolus organizer regionprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005730, GO:0005634, GO:0030874, GO:0044454, GO:0044452, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K35, chain A
Confidence level:very confident
Coverage over the Query: 87-301,346-392
View the alignment between query and template
View the model in PyMOL
Template: 1J8F, chain A
Confidence level:very confident
Coverage over the Query: 39-109,140,154-335,351-386
View the alignment between query and template
View the model in PyMOL
Template: 2HJH, chain A
Confidence level:very confident
Coverage over the Query: 4-104,139-140,154-304,349-417
View the alignment between query and template
View the model in PyMOL